KEGG   Oryctolagus cuniculus (rabbit): 100348713
Entry
100348713         CDS       T03373                                 

Gene name
ERCC1
Definition
(RefSeq) ERCC excision repair 1, endonuclease non-catalytic subunit
  KO
K10849  DNA excision repair protein ERCC-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03420  Nucleotide excision repair
ocu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100348713 (ERCC1)
   03460 Fanconi anemia pathway
    100348713 (ERCC1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100348713 (ERCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100348713 (ERCC1)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100348713 (ERCC1)
SSDB
Motif
Pfam: Rad10
Other DBs
NCBI-GeneID: 100348713
NCBI-ProteinID: XP_017195225
LinkDB
Position
Un
AA seq 234 aa
MDPGEAEEGVPPPAGAPPRKRFVIPLEENEAPSAGAKPLFRSTRDLPAVETPAQPAPQTY
AEYAISRSPAGAGALCPPGAEPLAGETPNQALKPGTKSNSIVVSPRQRGNPVLRFVRNVP
WEFGEVLPDYVLGQSTCALFLSLRYHHLHPDYIHARLQSLGKSFALRVLLVQVDVKDPQQ
ALKELAKMCILADCTLVLAWSPEEAARYLETYKAYEQKPADLLMEKLEHSFLSG
NT seq 705 nt   +upstreamnt  +downstreamnt
atggaccctggggaggccgaggagggggtgccgccgcccgcaggggcccccccaagaaag
agatttgtcatcccgctggaggagaatgaggccccttccgcaggggccaagcccttgttc
agatccacgcgggaccttcccgccgtggagaccccggcccagccggccccccagacctat
gcggagtatgccatctctcggtcccccgcaggggctggagccctgtgccccccgggggca
gagcccctggcaggagagacccccaaccaggccctgaaaccggggacaaagtccaacagc
atcgttgtgagcccccggcagaggggcaaccccgtgctcaggttcgtgcgcaatgtgccc
tgggagttcggcgaggtcctgcctgactacgtgctgggccagagcacctgcgccctcttc
ctcagcctgcgctaccaccacctgcaccccgactacatccacgcgcgcctgcagagcctg
gggaagagcttcgcgctgcgcgtcctgctcgtgcaggtggacgtgaaagaccctcagcag
gccctgaaggagctggccaagatgtgcatcctggccgactgcaccctggtcctggcctgg
agccccgaggaggccgcgcggtacctggagacctacaaggcctacgagcagaagccggca
gacctgctgatggagaagctggagcacagcttcctgtccgggtga

DBGET integrated database retrieval system