KEGG   Oryctolagus cuniculus (rabbit): 100348778
Entry
100348778         CDS       T03373                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04217  Necroptosis
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu04917  Prolactin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04931  Insulin resistance
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05145  Toxoplasmosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100348778 (STAT3)
   04066 HIF-1 signaling pathway
    100348778 (STAT3)
   04068 FoxO signaling pathway
    100348778 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100348778 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100348778 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100348778 (STAT3)
   04062 Chemokine signaling pathway
    100348778 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100348778 (STAT3)
   04917 Prolactin signaling pathway
    100348778 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    100348778 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348778 (STAT3)
   05206 MicroRNAs in cancer
    100348778 (STAT3)
   05205 Proteoglycans in cancer
    100348778 (STAT3)
   05203 Viral carcinogenesis
    100348778 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100348778 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100348778 (STAT3)
   05221 Acute myeloid leukemia
    100348778 (STAT3)
   05223 Non-small cell lung cancer
    100348778 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100348778 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100348778 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100348778 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    100348778 (STAT3)
   05161 Hepatitis B
    100348778 (STAT3)
   05160 Hepatitis C
    100348778 (STAT3)
   05163 Human cytomegalovirus infection
    100348778 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100348778 (STAT3)
   05169 Epstein-Barr virus infection
    100348778 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100348778 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100348778 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100348778 (STAT3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100348778 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 100348778
NCBI-ProteinID: XP_002719441
Ensembl: ENSOCUG00000011034
UniProt: G1T0H3
LinkDB
Position
19
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGDGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcaactcgacacgcggtacctggagcagctgcaccag
ctgtacagcgacagcttccccatggagctccggcagttcctggccccgtggattgagagt
caagactgggcatatgcggccagcaaagaatcgcatgctacgttggtgttccataatctc
ctgggtgagattgaccagcagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatctcgagaagccaatggag
attgcccgaatcgtggcacggtgcctgtgggaagagtcccggctcctccagacagcagcc
actgcagcccagcaaggaggccaggccaaccaccccacggctgctgtggtgacggagaag
cagcagatgctggagcagcacctgcaggatgtccgcaagagagtgcaggatctagagcag
aaaatgaaagtggtagagaatctgcaggatgactttgatttcaactataaaaccctcaag
agccaaggagacatgcaggacctgaatggaaacaaccagtccgtgacgaggcagaagatg
cagcagctggaacagatgctcaccgcgctggaccagatgcggagaagcattgtgagcgag
ctggcagggcttttgtctgcaatggagtacgtgcagaaaactctcacggacgaagagctg
gctgactggaagaggcggcagcagatcgcctgcatcggaggccctcccaacatctgccta
gaccgtctagaaaactggataacctcattagcagaatctcaacttcagactcgccaacaa
attaagaaactggaggaactgcaacaaaaagtatcctacaaaggggaccccatcgtgcag
caccggcccatgctggaggagaggattgtagagctgttccgaaacctgatgaaaagtgcc
tttgtggtggagcggcagccctgcatgcccatgcaccccgaccggccgctggtcatcaag
actggagtccagttcaccacaaaagtcagattgctggtcaaatttcctgagttgaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggacgtggcggctctccgagga
tcccggaagtttaacatcctgggcacaaacaccaaagtcatgaacatggaagagtccaac
aacggcagcctgtctgcagagttcaagcacttgaccctgcgggagcaaagatgtggcaac
gggggtcgcgccaattgtgatgcctccctgattgtgacggaggagctgcacctgatcacc
tttgagactgaggtgtaccaccaaggcctcaagattgacctggagacccactccctgccc
gtggtggtgatctccaacatctgccagatgccgaacgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagcctccgatcgggacc
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccacgaagcgggggctg
agcatcgagcagctgaccacgctggccgagaaactcctaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttttcc
ttctgggtctggctggacaacatcattgaccttgtgaaaaagtatatcctggccctttgg
aatgaagggtacataatgggctttatcagcaaggagcgggagcgggccatcctgagcacc
aagcccccaggcaccttcctactgagattcagcgaaagcagcaaagagggaggtgtcacc
ttcacgtgggtggagaaggacatcagtgggaagacccagatccagtcggtggagccgtac
accaagcagcagctgaacaacatgtcgtttgctgagatcatcatgggctataagatcatg
gacgccaccaacatcctggtgtctccactcgtctatctctaccccgacattcctaaggag
gaggcgttcggaaagtactgtcggccggagagccaggagcaccctgaagctgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgacggtgctgagccctcagcaggagggcagtttgagtccctcacgtttgacatggag
ttgacctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system