KEGG   Oryctolagus cuniculus (rabbit): 100348842
Entry
100348842         CDS       T03373                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04012  ErbB signaling pathway
ocu04062  Chemokine signaling pathway
ocu04110  Cell cycle
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04310  Wnt signaling pathway
ocu04340  Hedgehog signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04657  IL-17 signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04728  Dopaminergic synapse
ocu04910  Insulin signaling pathway
ocu04916  Melanogenesis
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05010  Alzheimer disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05135  Yersinia infection
ocu05160  Hepatitis C
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348842 (GSK3B)
   04310 Wnt signaling pathway
    100348842 (GSK3B)
   04340 Hedgehog signaling pathway
    100348842 (GSK3B)
   04390 Hippo signaling pathway
    100348842 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100348842 (GSK3B)
   04150 mTOR signaling pathway
    100348842 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100348842 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100348842 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100348842 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100348842 (GSK3B)
   04657 IL-17 signaling pathway
    100348842 (GSK3B)
   04662 B cell receptor signaling pathway
    100348842 (GSK3B)
   04062 Chemokine signaling pathway
    100348842 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100348842 (GSK3B)
   04917 Prolactin signaling pathway
    100348842 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100348842 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100348842 (GSK3B)
   04916 Melanogenesis
    100348842 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100348842 (GSK3B)
   04722 Neurotrophin signaling pathway
    100348842 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100348842 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348842 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100348842 (GSK3B)
   05225 Hepatocellular carcinoma
    100348842 (GSK3B)
   05226 Gastric cancer
    100348842 (GSK3B)
   05217 Basal cell carcinoma
    100348842 (GSK3B)
   05215 Prostate cancer
    100348842 (GSK3B)
   05213 Endometrial cancer
    100348842 (GSK3B)
   05224 Breast cancer
    100348842 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100348842 (GSK3B)
   05020 Prion disease
    100348842 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100348842 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100348842 (GSK3B)
   04931 Insulin resistance
    100348842 (GSK3B)
   04934 Cushing syndrome
    100348842 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100348842 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100348842 (GSK3B)
   05162 Measles
    100348842 (GSK3B)
   05163 Human cytomegalovirus infection
    100348842 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100348842 (GSK3B)
   05165 Human papillomavirus infection
    100348842 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100348842 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100348842 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100348842 (GSK3B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100348842 (GSK3B)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100348842 (GSK3B)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100348842 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100348842
NCBI-ProteinID: XP_002716706
Ensembl: ENSOCUG00000014932
UniProt: A0A5F9CM08
LinkDB
Position
14
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGRFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtaactacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagttatacagacactaaa
gtgattggaaatgggtcatttggtgtagtatatcaagcaaaactttgtgattcaggagaa
ttggttgccatcaagaaagtattacaggacaagagatttaagaaccgagagctccagatt
atgagaaagctagatcattgtaacatagtccgtttgcgttatttcttctactcgagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacactccctgtcatctatgtcaagttg
tatatgtatcagctgtttcgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgttttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctccagtatagatgta
tggtctgcaggctgtgtattggctgagctgttgctaggacagccaatatttccaggagac
agtggtgtggatcagttggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaacccaaattacacagaattcaaatttcctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacgtttcacctcaggagtgcgggtcttccgaccc
cgaactccaccagaggcaattgcactgtgtagccgtctgctggagtacacaccaactgcc
cgactgacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctttggctaccatccttattcctcctcatgctaggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagatgctaatgctggagaccgtggacag
accaataatgccgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system