KEGG   Oryctolagus cuniculus (rabbit): 100348948
Entry
100348948         CDS       T03373                                 

Gene name
WDR62
Definition
(RefSeq) WD repeat domain 62
  KO
K21762  WD repeat-containing protein 62
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100348948 (WDR62)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100348948 (WDR62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046
Other DBs
NCBI-GeneID: 100348948
NCBI-ProteinID: XP_008247780
Ensembl: ENSOCUG00000024029
UniProt: G1TFY4
LinkDB
Position
Un
AA seq 1534 aa
MAALGPGGYARNDAVEKLPSVMAGVPARKGQSSPPPAPALCLRRRTRLSAAPEDTVQNRV
SLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILNPKENKQQHILNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKSQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLDVSTEAKVTGTVPL
VGRSGILGELHNNIFCGVACGRGQVAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFEAHSLHYLANLPKPHYLGVDVALGLEPSFLFRRKAEAVYP
DTVALTFDPVHQRLSCIYKDHSIYVWDVKDINKVGKLWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNMDNCRDSHWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGSESGTPVDAKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGHRDIQMISCG
ADKSIYFRSAQQASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECVAKMFGHSEIVTG
MKFTYDCRHLITVSGDSCVFIWHLGPEITNCMKQHLLEMDHQEQQQHTKDQNWSSDPRQE
TCTTTPRAPRSLSPGEQTEEELEEECEPEELLTTPSKERLDPDPRCLLTNGKLPLWAKRL
LGDDDVADGSAFHPKRSYQPHGRWAERAGQEPLKTILDARELDCYFTPMKAESLDDSILD
TVEPQNLAGLLNESESPREDGCGQRPFLPPQREPAEASELFIYSLEAEVPVPGTDSESFE
KEAEAGPGDQLADSYLRVSSISSKDQSPPEDSGESDSDVECSQASPPRPEPGPRCAGTTP
HSRGCPGPSEEELPRPEGPSVPSSSLPQTPEQEKFLRHHFETLTDAHPEELFHGSLGDAN
VPEAEDVFLNPRLSISAQFLSRLQKPSRLTQAFPARLPRHLAKSPEVKPTDSRGSQPRAE
PLRAGAGHASPEGSTVRCGEKAAETSEAWCPRTSCLTCPAPCVPSSPVPPTDRKPPTPTS
VPPPGLAPGVHTPSTCSYMEATASFRAKMSRSISLEDGEGSVVAELARALRRPSSVGELA
SLGQELHPITATATPSSGSESQGPTLPSRGNHEARANLRLTLPSVCDRLLLSPPPLESPT
CVWSQEPTEAQPCVMAPAPGPMDNNVPRPHHSAFLTRLPAPEPLNSPAHPNSPQFPEARP
GVPSCTASFLEPTPGALSLIRGSPGHWGELGLPAEVPPPVPLELTSVGSVVRRLQTAFQE
ALGLYHTLVSSNQMGAERRQAQTELASTFLWIHSQLEATDWLVGTNMAPAQALPSPAPPS
PPPLCPLASPDLHALLEHYSELLVQAVRRKARGD
NT seq 4605 nt   +upstreamnt  +downstreamnt
atggcggccttagggcccggaggctacgcgcggaacgatgcagtcgagaagctgccatct
gtcatggcgggagttccggcgcggaagggccagtcctctccgcccccggccccagcgctc
tgcctccggcggcggacgcgactgtcggcggcgcccgaggacaccgtgcaaaaccgggtg
tctcttgagaaggtccttggcatcacagcccagaacagcagtggcctcacctgtgaccct
ggcacaggccacgtggcctacctagcaggctgtgtggtagtgattttgaaccctaaggag
aacaagcagcagcatatcttgaacaccgccaggaagtccctgagcgctctggccttctct
cctgatgggaagtacatagtgacaggagagaatgggcacaggccagcggtgcgcatctgg
gacgtggaggagaaaagtcaggtggcggagatgctgggccacaagtatggcgtggcctgt
gtggccttctcacccaatatgaagcacatcgtgtccatgggataccagcacgacatggta
ctcaacgtctgggactggaagaaagacatcgtggtggcctccaacaaggtgtcgtgcagg
gtcatcgccctgtccttctctgaagatagcagctattttgtcactgttgggaaccggcac
gtgaggttctggttcttggatgtctccacagaagcaaaggtgacaggtacagtgcccctc
gtagggcgctcgggcatcctgggcgaacttcacaacaacatcttctgtggcgtggcgtgt
ggccggggccaggtggcaggcagcaccttctgtgtgtcctactcgggcctgctctgccag
ttcaacgagaagagggtgctggagaagtggatcaatctgaaggtctccctgtcctcctgc
ctctgcgtcagccaggagctcatcttctgcggctgcacagatgggatagtccgcatcttc
gaggcccacagcctgcattacctcgccaacctgcccaagccacactaccttggggtagat
gtggcactgggcctggagcctagcttcctcttccgcaggaaggcggaagccgtctatcca
gatacagtggcactgacgtttgatcccgtgcaccagcggctgtcctgcatttataaggac
cacagcatctatgtctgggatgtcaaggatatcaacaaagtgggcaagttgtggtcagag
ctcttccatagctcctacgtttggaatgtggaggtgtatcctgagtttgaagatcagaga
gcttgtttgccatcaggatcttttctgacttgttcctcagacaacaccatccgcttctgg
aacatggataactgccgtgactctcactggcagaaaaacatcttcagcaatacccttctg
aaggtagtgtacgtggagaacgacatccagcacctgcaggacatgtcacacttcccagac
cgcggcagcgagagcgggacacccgtggacgcgaaagccggggtgcgcgtcatgcaggtc
agtcctgatggccagcacttggcttcaggcgaccgcagtggaaatctgaggatccacgag
ctgcacttcatggatgagctggtgaaggtggaggcccatgatgctgaggtgctatgcctg
gagtactccaagcctgagacagggttgaccttgctggcctcggccagtcgggaccgcctg
atccacgtgctgaacgtggagaagaactacaacctggagcagaccctggatgaccactcc
tcctccatcacggccattaagtttgctggccacagagacatccagatgatcagctgtggg
gccgacaagagcatctacttccgcagtgcccagcaggcctcagatgggctccacttcgtc
cgtacccaccacgtggcagagaaaaccaccttgtatgacatggacattgacatcacccag
aagtacgtggccgtggcctgccaggaccgcaacgtgagggtctacaacaccgtgaacggg
aagcagaagaagtgctacaagggctcccagggtgatgaaggatccctgctgaaggtccat
gtggacccctcaggcaccttcctggccacaagctgctctgacaaaagcatctcggtgatc
gacttttactcgggcgagtgtgttgccaagatgttcggtcactcagaaatcgtcactggc
atgaagttcacctatgattgtcgtcacttgatcacagtgtccggagacagctgtgtgttc
atctggcacctgggccccgagatcaccaactgcatgaagcagcacttgttggagatggac
caccaggagcaacagcagcacaccaaggaccagaactggagcagcgaccccaggcaggag
acgtgcacgaccacaccccgtgcccctcgctcgctgagtcctggagagcagacagaggaa
gagctggaggaggagtgcgagccagaagagctgctgacgacaccgtccaaggagcgcttg
gatccagatcctcgctgcctgctgactaatggcaagctgccactttgggcaaagcggctg
ctaggagatgacgatgtggcggacggctcggccttccaccccaagcgcagctaccagccc
cacggccgctgggcggaacgggctggccaggagcccctcaagacgatcctggatgcgcgg
gagctggattgctactttacccccatgaaggccgagagcctggacgactccattctggac
acggtggagccacagaacctggcaggtctgctgaacgagtcagagagcccccgcgaggac
ggctgcgggcagcgccccttcctgccgccacagagggagccagcggaggccagcgagctc
ttcatctactccctggaggcagaggtgccagtcccggggacagacagcgagtccttcgag
aaggaggccgaggcagggcctggagaccagctcgctgactcctacctcagggtctcctcc
atcagctcgaaggatcagagcccacccgaggactctggggagtcagacagcgatgtggag
tgcagccaggcctcccctcctcggcccgagccagggcctcgctgtgccggaacgacgccc
cactcacgaggctgcccaggcccctcggaggaggagctgccccggcccgaggggcccagc
gtgcccagcagctccctgccccagacccctgagcaggagaagttcctccgccaccacttc
gagaccctcactgacgcccaccctgaagagctcttccacggctccctgggggacgcgaac
gtccctgaggccgaggacgtcttcctcaacccccggctgagcatctcggcccagttcctc
tcacgcctccagaagccatccaggctcacccaggccttccctgcccggctgccccgccac
ctggccaagtctcccgaggtgaagcccacggacagcagggggagccagcccagagccgag
cccctgcgagcaggtgctggccacgcctccccggaggggagcacggtccgctgtggggag
aaggctgcggagacctcggaggcctggtgcccacggacctcctgcctcacctgcccggct
ccctgtgtcccttcctccccagtgcctcccacagacaggaagccgccgacacccacatcc
gtacctccccccggcctggctccgggtgtccacaccccctccacctgttcctacatggag
gccactgccagcttccgtgccaagatgtcacgcagcatctccctggaggacggtgaaggc
tctgttgtggctgagctggccagggccctcagaaggccctcatctgtgggggagctggcc
tccctgggccaggagctccaccccatcaccgccacagcgacacccagttctggcagcgag
agccaagggcccaccctcccctcccggggcaaccacgaggcccgggccaacctgagactg
accctgccaagtgtctgtgacaggctcctgttgtccccaccccctctggagtcacccaca
tgtgtctggtcccaggagcccacggaagcccagccctgtgtcatggccccagcacctggc
cccatggataataatgtcccaagaccccaccactctgcctttctcacaaggctcccagct
cctgagcccctcaactctcctgcccaccccaacagcccccagtttccagaggccaggcct
ggagtccctagttgcactgcttccttcctggagcccacccctggtgcactcagcctgatc
cggggcagccctggccactggggggagctggggctgccggctgaagtcccgcccccagtg
ccccttgagctgaccagcgtggggagtgtcgtgcgcaggctgcagactgccttccaagaa
gccctgggcctttaccacacgttggtctccagcaaccagatgggggccgagcggcggcag
gcacagaccgagctggcgtccaccttcctttggatccacagccagctggaggccaccgac
tggctagttgggaccaacatggcccccgcccaggccctgcccagcccagcgcccccctcc
ccacctccgctgtgcccgctggccagcccagacttgcacgccctgctagaacactactcg
gaactgctggtacaggccgtgcggaggaaggcgcggggggactga

DBGET integrated database retrieval system