KEGG   Oryctolagus cuniculus (rabbit): 100349021Help
Entry
100349021         CDS       T03373                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00480  Glutathione metabolism
ocu00980  Metabolism of xenobiotics by cytochrome P450
ocu00982  Drug metabolism - cytochrome P450
ocu00983  Drug metabolism - other enzymes
ocu01524  Platinum drug resistance
ocu05200  Pathways in cancer
ocu05204  Chemical carcinogenesis
ocu05225  Hepatocellular carcinoma
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100349021 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100349021 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    100349021 (GSTO1)
   00983 Drug metabolism - other enzymes
    100349021 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100349021 (GSTO1)
   05204 Chemical carcinogenesis
    100349021 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    100349021 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100349021 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    100349021 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100349021 (GSTO1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100349021 (GSTO1)
Transporters [BR:ocu02000]
 Other Transporters
  Pores ion channels [TC:1]
   100349021 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 100349021
NCBI-ProteinID: XP_002718774
Ensembl: ENSOCUG00000008702
UniProt: G1SVP7
LinkDB All DBs
Position
18
AA seq 241 aa AA seqDB search
MSGDATKSLGKGSPPPGPVPEGVIRLYSMRFCPFAERTRLVLKAKGIRHEIININLKNKP
DWFFKKNPLGLVPVLEDSKGQVVYESVITCEYLDEVYPGKKLWPEDPYEKARQKMIFEVF
TTIPPLSSSYTRKHKTEDCSGLKENLRKEFSKLEEILANKKTTFFGGSSVSMTDYLIWPW
FERLEGLELTDCLDHTPKLKLWMAAMKKDPTAAALLLNVNHQRHFLELYLKNSHEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggacgcaaccaagagccttgggaagggaagcccgcccccagggcctgtcccg
gagggcgtgatccgcctctacagcatgaggttctgcccgtttgcggagaggacgcggctg
gtcctgaaggccaagggaatccgtcatgaaatcatcaatatcaacctaaagaacaagcct
gactggttttttaagaagaatccccttggactggtaccagttctggaagacagtaagggg
caagtggtctacgaatctgtcatcacctgtgaatacctggatgaagtgtatccagggaag
aagctgtggccagaggacccctatgagaaagctcgccagaagatgatctttgaggtgttc
accacgataccacctttgtcatcaagctacactagaaagcacaaaactgaagactgctct
ggcctaaaagaaaacttgcgcaaagaattcagcaaactagaggagattctggctaacaag
aagacaaccttctttggtggcagttctgtctctatgactgattacctcatctggccctgg
tttgaacggctggaaggactggagttaactgattgtctggaccacacccccaaactcaag
ctctggatggcagccatgaagaaagatcccacagcagcagcactccttcttaacgtgaat
caccagcgccatttcttagagctgtacttaaagaacagccatgaggcctgcgactatggg
ctctga

DBGET integrated database retrieval system