KEGG   Oryctolagus cuniculus (rabbit): 100349206
Entry
100349206         CDS       T03373                                 

Gene name
SLC31A1
Definition
(RefSeq) solute carrier family 31 member 1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100349206 (SLC31A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100349206 (SLC31A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100349206 (SLC31A1)
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   100349206 (SLC31A1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 100349206
NCBI-ProteinID: XP_017200727
Ensembl: ENSOCUG00000005040
UniProt: G1SN32
LinkDB
Position
1
AA seq 176 aa
MNHSHHMGHMTTTASHSHGGGDGSMMMMMPMTFYFGFKNVELLFSGLVINTAGEMAGAFV
AVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLL
QTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaatcattcccaccatatgggccacatgaccaccacagcctcacactcccatggtgga
ggagacggcagcatgatgatgatgatgcctatgacgttctactttggctttaagaatgtg
gaactgttgttttctggtttggtgatcaatacagctggagaaatggctggagcttttgtg
gcagtgtttctactagcaatgttctatgagggactcaagatagcccgagagagcctgcta
cggaagtcacaagtcagcattcgctacaattccatgcctgtgccaggaccaaatggaacc
atccttatggagacacataaaactgttgggcagcagatgctaagctttcctcacctcctg
caaacagtgctgcatatcatccaggtggtcatcagctacttcctcatgctcatcttcatg
acctacaacgggtacctctgtattgccgtagcagccggggccgggacaggatactttctc
ttcagctggaagaaagcagtggtagtggacatcacagagcattgtcattaa

DBGET integrated database retrieval system