KEGG   Oryctolagus cuniculus (rabbit): 100349299
Entry
100349299         CDS       T03373                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03440  Homologous recombination
ocu04064  NF-kappa B signaling pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05202  Transcriptional misregulation in cancer
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100349299 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100349299 (ATM)
   04068 FoxO signaling pathway
    100349299 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100349299 (ATM)
   04210 Apoptosis
    100349299 (ATM)
   04115 p53 signaling pathway
    100349299 (ATM)
   04218 Cellular senescence
    100349299 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100349299 (ATM)
   05206 MicroRNAs in cancer
    100349299 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349299 (ATM)
   05170 Human immunodeficiency virus 1 infection
    100349299 (ATM)
   05165 Human papillomavirus infection
    100349299 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100349299 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100349299 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100349299 (ATM)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100349299 (ATM)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100349299 (ATM)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100349299 (ATM)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100349299 (ATM)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100349299 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 100349299
NCBI-ProteinID: XP_008260054
Ensembl: ENSOCUG00000014663
UniProt: G1T7X7
LinkDB
Position
1
AA seq 3056 aa
MSLALNDLLICCRHLEHDRATERRKEVEKFKRLIRDPETVQQLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETECLRTAKPNVSASTQASRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMETVKDSSNGGVYAADCSNILLKDILSVRKYWCEIPQQQWLDLFSVYLRLYLKPSQ
DINRVLVARIIHAVTKGCCLQTDGLNSKFLDFFSKAIQYARQEKSSAGLNHILAALIIFL
KTLAINCRIRACELGDEILPTLLYIWAQHRLNDSLKEVIIELFQLQVSIHHPKGAKTEDR
GAFKSAKWQSILYNLYDLIVNEISYIGSRGKYSSGSRNIAVKENLIELMADICHQVFNED
TRSLEISQSYTTTQRESSEYSTPCKRKKIELGWEVIKDHLQKSQNDFDLVPWLQITTQLI
SKYPASLPNHDLSSLLMILYQLLPQQRRGERTPYVLRCLTEVALCQGKKSDLESSQKSDL
LKLWIKIWTMAFRGISSEQVQAENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCSTVY
CLALAMSSCIVPETVKTGIELNICEVNRSFSLKELIMKWLLFYQLEDDLEDSIELPPILH
SNFPHCILEKILVSLTMKNSKAAMKFFQSGQECEHQKVKEEPSFSEIEELFLQTTFDKMD
FLTVVKECATEKLQSSIGFSVHQNLKESLNRYLLGLSEQLLNNYSSEITNLETLVRCSSL
LVGVLGCYSSMGIIAEEEACKSELFQKAKSLMQCAGESITLFKNKTYEESRIGSLRNMMH
ICTSCLCNCTKQNPNKITSGFFLRLLTSKLMNDIADICKSLATLIKKPFDCGEIESMEDD
TTENLMEVEDQSSMNLFNDHSASSESDANEFGENQNTIGAMNPLAEEYLSKHDLLLLDMV
KFLCMCVTTSQTSTVSFRAADIRRKLLMLVDSSILDPTKSVHLHMYLVLLKELPRGEYPL
PMEDIVELLKPLSNVCSLYRRDQDVCKTVLNHVLPVVTNLGQGNLDAENTRDAQGQFLTV
IGAFWHLTRERKCTFSVRVALVQCLKTLLEADPYSKWAILNVMGKDFPVNEVFPQFLADD
HHQVRMLAAESINRLFQDMKQGDCPRLWKALPLKLQQTAFDNACLKTQEGMREVSHSAEN
PEILDETYNRKSVLLMMIAVVLYCSPVCEKQALFALCKSVKENGLEPHLVKKVLEKVSEA
FGYRNLEDFMASHLDYLVLEWLNCQNTEYRLSSFPYILLNYKNVEDFYRSCYKILIPHLV
IRSHFDEVKAIANQIQEDWKSLLVDCFPKILVNILPYFAYEDAKDSGMAQQREIASTVYD
MLKSENLLGKQIDHLFISNLPEIVVELLMTLHEPANSDASQSTDLSEFSGDLDPAPNPPH
FPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYRRHRILK
IYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDLLSR
VCQTAVTHCKDALENHLHVIVGTLIPLVHDQVEVQEQVLDLLKYLVIDNKDNENLYITIK
LLDPFPDHVVFKDLRITQQKIKYCRGSFSLLEEINHFLSVSIYDALPLTRLEGLKDLQRQ
LAKHKDQMMDLMRASQDNPKDGIMVKLVITLLHLSKTAVNHTGEREVLEAVGSCLGELGP
IDFSTIAIQHNKDTSYTKAFKLFEDKELCWTLIILTYLNNTLVEDCVRVRSAAATCLKNI
LATKTGHSFWEVYKMSTDPMLIYLQPFRTSRKKFLEVPRPDKESPLESLDDTSLWIPQSE
NHDIWIKTLTCALLDSGGIKSEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWRN
LLSAHIQGFFTSCFRHNSQTSRSTTPANLDSDSEHFFRCCVDKKSQRTMLAVVDYMRRQK
RPSIGTVFDDAFWLDFNYLEVAKVAQSCAAHFTALLYAEIYADKKSLDDQEKRSLTFEEG
SQNTTISSLSEKSREETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHEA
VWDKALVTYDLETAICPSTRQAGIIQALQNLGLCHILSVYLKGLDHENVECCAELQELHY
QAAWRNMQWDHCTSVNKGIEGTSYHESLYNALQSLRDREFSTFFESLKYARVKEVEELCK
GSLESVYSLYPRLSRLQAIGELENIGELVSRSVMDKQFSEVYVKWQKHSQLLKDSDFNFQ
EPIMALRTVILEILMEKEVNNSQRECFKDILTKHLTEFSILARTFKNTQLPERAVFQIKQ
YNSVSHEVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDTSCRENDSRLKLIHTECLRV
CGNWLAETCLENPTVIMQTYLEKAVEVAESCDGENNDELRNGKMKAFLSLARFSDTQYQR
IENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDRK
RFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVPEVNGMMKGPGMEIPSYKFLPLM
YQLAARMGTKMMGGVGFHEVLNNLISRVSMDHPHHTLFIILALANANKDEFLTKPEAARR
SRITKNAPKQSSQLDEDRMEAANNIISTIRSKRPQMVRSVEALCDAYILLANLDATQWKT
QRKGIIIPADQPITKLKNLEAVVVPTMEIKVDPTGEYENLVTIQSFKAEFRLAGGINLPK
IIDCVGSDGRERRQLVKGRDDLRQDAVMQQVFQLCNMLLQRNTETRKRKLTICTYKVVPL
SQRSGVLEWCTGTIPIGEFLTDSEGGAHKRYRPTDFSSVQCQKKMIEIQKKSFEEKYKTF
MNICKHFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHIQNILINE
QSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRN
SQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETEFQSTPNADDQECKRNLSDIDQ
SLNKVAERVLIRLQEKLKGVEEGTVLSVSGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9171 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcatcttgaacatgatagagct
acagaacgaaggaaagaagttgagaaatttaaacgcttgattcgggatccagaaacagtt
caacagttagatcggcattcagattcgaaacaaggaaaatatttaaattgggatgctgtt
tttagatttttacagaaatatattcagaaagaaacagaatgtctgagaacagcaaaacca
aatgtatcggcctcaacacaagcatccaggcaaaaaaagatgcaagaaatcagtagtttg
gtcaagtacttcatcaagtgtgcaaataaaagagcacccaggttaaaatgtcaagaactt
ttgaattatatcatggaaacagtgaaagattcatctaatggtggcgtttatgcagctgat
tgtagcaatatactactgaaagacattctttcagtgagaaaatactggtgtgaaatacca
cagcaacagtggctagacttattctctgtgtacctcaggctgtatctgaaaccttcacag
gacattaatagagttttggtggcaagaataattcatgctgtgaccaaaggatgctgtttg
caaactgatggattaaattccaaatttttggattttttttccaaggctattcaatatgca
agacaagagaagagttctgcaggtttaaatcatatcttagcagcccttataatctttctg
aagactttagccatcaattgtcgaattcgagcttgtgaattaggagatgaaattcttcct
actttgctttatatttgggctcaacatagacttaatgattctttaaaagaagtaattatt
gaattgtttcaactgcaagtttctatccatcacccgaaaggagccaaaaccgaagacaga
ggtgctttcaaatcagcaaaatggcaaagtatcctatataacttatatgatttgatagtg
aatgaaataagttatatagggagtagaggaaaatatagttcaggatctcgaaacattgct
gtcaaggaaaatttgattgaattgatggctgatatttgtcaccaggtgtttaatgaagat
accagatctttggaaatttctcagtcttacactactacacaaagagaatctagtgaatac
agtacaccttgcaaaaggaagaaaatagaactaggctgggaagtaataaaggatcatctt
cagaagtcacagaatgattttgatcttgtgccttggctacaaattacaacccagttaata
tcaaaataccctgcaagtttacctaatcatgatctgtcttcattactgatgatactctac
cagcttcttcctcaacagcgacgtggggaacgcacaccatatgttttacgatgtcttaca
gaagttgcattgtgtcaaggcaagaaatcagacttagaaagctcacagaagtcagattta
ttgaaactctggattaaaatttggaccatggccttccgtggtataagttctgaacaagtc
caagccgaaaattttggcctgttgggagccataattcaaggtagtttagttgaggtcgac
agagaattctggaagttatttactgggtcagcctgtagaccttcatgttctactgtatac
tgtttggctttggcaatgtctagctgcattgttccagaaacagtaaaaacaggaatagag
ttaaatatatgtgaagtaaacagaagtttttctttaaaggaattgataatgaaatggctc
ttattttatcaattagaagatgacttagaagacagtatagaattgccccctattcttcac
agtaattttcctcattgcatactggagaaaattctggtgagtctcactatgaaaaactct
aaagctgcaatgaagtttttccaaagtgggcaagaatgtgaacaccaaaaagttaaagaa
gagccttcattctctgaaatagaagaactatttcttcagacaacttttgacaagatggat
tttttaactgttgtaaaagaatgtgcaacagaaaagcttcaatccagtattggattttct
gttcaccagaatctcaaggaatcactgaaccgctatcttctgggattatcagaacaactt
ctaaataattattcatctgagattacaaatttagaaacactcgtccggtgttcaagtctt
ttggtgggtgttctcggctgctattcttctatgggtataatagctgaagaggaagcatgt
aaatcagaattgttccagaaagccaagtctttaatgcagtgtgcaggagaaagcataact
ctgttcaaaaataagacatatgaggaatctagaattggttccctgagaaatatgatgcat
atatgtacaagttgcttatgtaactgtaccaagcagaatccaaataagattacatctggc
tttttcctacgattgttaacatcaaagctaatgaatgacattgcagatatttgtaaaagt
ctagcaaccttaataaaaaagccatttgactgtggagaaatagaatcaatggaagatgat
actactgaaaatctaatggaggtagaagatcagtcatccatgaatctctttaatgatcac
tctgctagtagtgagagtgatgcaaatgaatttggagagaaccaaaatactattggtgcc
atgaatccattagctgaagaatatctgtcaaagcacgatctccttcttttagacatggtc
aagttcttgtgtatgtgtgtaactacttctcaaaccagtactgtgtcatttagagcggct
gatattcggagaaaattgttgatgctagttgattctagcatattagaccctactaaatct
gtccacctacacatgtatttagtgcttttaaaggagcttcccagaggagagtatcccttg
ccaatggaagatattgttgaacttctgaaaccactatccaatgtgtgttctctgtatcgt
cgtgaccaagatgtttgtaaaacagttttaaaccatgtccttcctgtagtgacaaaccta
ggtcaaggcaatttggatgctgagaacacaagagatgctcaaggacaattccttacagtg
attggagcattttggcatctaacaagggagaggaaatgcacattctctgtaagagtggca
ctagtacagtgcctgaaaactttgcttgaggctgatccttattcaaaatgggctattctt
aatgtaatgggtaaagattttcctgtaaatgaagtgtttccacagttccttgctgatgat
catcaccaagttcgcatgttggctgcagagtcaatcaatagattattccaagatatgaaa
caaggagattgtcccagactgtggaaagcacttcctttgaagcttcagcagactgctttt
gacaatgcatgcttgaaaactcaggaaggaatgagagaagtgtcccacagtgctgagaac
cctgaaattttggatgagacttataatagaaaatctgttttattgatgatgatagctgtg
gttttatactgtagccctgtctgtgaaaaacaggctttgtttgcactttgcaaatctgta
aaagagaatggattagaacctcaccttgtgaaaaaggttttggagaaagtttctgaagct
tttggatatagaaatttagaagactttatggcttctcatttagattatttggttttagaa
tggcttaattgtcaaaatactgaatacagattatcttcctttccttatattttattaaac
tacaaaaatgttgaggatttttatagatcttgttataaaatattgattccacatctggtg
attagaagtcatttcgatgaggtgaaagccattgctaatcagattcaagaagattggaaa
agtcttctagtagactgctttccaaagattcttgtaaatattcttccttattttgcctac
gaggatgcaaaagacagtgggatggcacagcaaagagagattgcttccacagtttatgat
atgcttaaaagtgagaacttattaggaaaacagattgatcatctgtttattagcaattta
ccagagattgtggtagagttattaatgacattacatgaaccagcaaattctgatgccagc
caaagcactgacctctctgagttttcaggggatttggatcctgctccgaatccacctcat
tttccatcacatgtgattaaagcaacatttgcctatatcagcaactgtcataaaacaaaa
cttaagagcattttagaaattctctctaaaagccctgattcctatcagaaaattcttctg
gctatatgtgagcaagcagcagagacaaataatgtttatagaaggcacagaattcttaaa
atatatcatctctttgttagtttattactgaaagatataaaaagtggcttgggaggagca
tgggcctttgttcttcgagatgttatttatactttgattcactatattaacaaacggcct
tctcgtttcatggatgtgtcattacgtagcttctccctttgttgtgacctattaagtcgg
gtttgccagacagcagtgactcactgtaaggatgctttagaaaaccatcttcatgttatt
gttggtacactgataccccttgtgcatgatcaagtggaggttcaggaacaggtattggac
ttgttgaaatacctagtaatagataacaaggataatgaaaacctttatatcacgattaaa
cttctagacccttttcctgaccatgttgtttttaaggatctacgtatcactcagcaaaaa
atcaagtactgtagaggatctttttcactcttggaggagattaatcattttctgtcagta
agtatttatgatgcacttccattgacaaggcttgaaggactgaaggatcttcagagacag
ctggcaaagcataaagatcagatgatggatcttatgagagcctctcaggataacccaaaa
gatggtattatggtgaagctggttatcaccttgttgcatttgtccaagacggcagtaaac
cacactggtgaaagagaagttttagaagctgttggaagctgcttaggagaactgggtcct
atagatttctccaccattgctatacagcataataaagatacatcttatactaaggccttt
aaattatttgaagataaagaactttgttggaccttaataatactgacctacctgaataat
acactggtagaagactgtgtcagagttcgatcagctgctgctacctgtttgaaaaatatt
ttagccacaaaaactggacacagtttctgggaggtttataagatgtcgactgaccccatg
ctgatctatttacaacctttcaggacatcgagaaaaaagtttttagaagttcccagacct
gacaaagaaagccctttagaaagcttggatgatacaagtctatggattcctcaaagtgaa
aatcatgacatttggataaagacactaacgtgtgctcttttggacagtgggggcataaaa
agtgaaattcttcaattattaaagccaatgtgtgaagtaaaaactgacttttgtcagact
gtgcttccttacttgattcatgatattttactccaagatacaaatgagtcatggagaaat
ctgctttctgcacatattcagggatttttcaccagctgttttagacacaactcacaaacc
agccgatccacaacacctgcaaatttggattcagattcagagcattttttccgatgttgt
gtggataaaaaatcccaaagaacaatgcttgctgttgtagactatatgagaagacaaaag
agaccctctataggaacagtttttgatgatgctttctggctggattttaattatctagag
gttgccaaggtagctcagtcttgtgctgctcactttacagcactactgtatgcggaaatc
tatgcagataagaaaagcctggatgatcaagagaaaagaagtcttacatttgaagaagga
agccaaaatacaactatttctagtttgagtgaaaaaagtagagaagaaactggaatcagt
ttacaggaccttctcttagaaatctacagaagtataggggagccagatagtctttatggc
tgtggtggagggaaaatgttacaaccactcaccagactgagaacatatgaacatgaagca
gtgtgggataaagccctggtaacgtatgatcttgagacagcaatatgcccatcaacccgc
caggcaggaataattcaggccttgcagaacttgggactgtgccatattctttcggtgtat
ttaaaaggtttagatcatgaaaatgtggagtgttgtgctgaactacaggaacttcattac
caagcagcatggaggaatatgcagtgggaccattgtacttctgtcaataaaggaatagaa
ggaaccagttaccatgaatcattgtacaatgctctgcaatccctgagagacagagaattc
tccacattttttgaaagtctaaaatatgccagagtaaaagaagtggaagaattgtgtaaa
ggcagccttgagtctgtgtattcactctaccccagacttagcagattgcaggccattgga
gaactagaaaacattggggagcttgtctcaagatcagtcatggataaacagttctctgaa
gtgtacgttaaatggcagaaacactcccagcttctcaaggatagtgactttaattttcag
gagcctatcatggctctacgcacagtcattcttgagatcctgatggaaaaagaagtgaat
aactcccagcgagaatgttttaaggacattctcaccaagcaccttacagaattctctata
ctggcccggactttcaagaacactcagctccctgaaagggcagtatttcaaattaaacag
tataattcagtgagtcatgaagtctctgagtggcagctggaggaagcacaagtgttctgg
gcaaaaaaagaacaaagtcttgccctgagtattctcaagcaaatgatcaagaagttggac
accagctgtagagagaatgattccaggctaaaacttatacacacagaatgtctgagagtt
tgtggtaactggttagcagaaacttgcttagaaaatcctacagtcatcatgcagacctat
ctagaaaaggccgtagaagttgctgaaagttgtgatggagaaaataatgatgagctcaga
aatgggaaaatgaaggcatttctctcattagcacggttctcagatactcagtaccagaga
attgaaaactacatgaaatcatcagaatttgaaaacaagcaagccctcctaaaaagggcc
aaagaggaagtgggcctcctgagggaacataagattcagactaacagatacacagtaaag
gttcagcgagagctggagctggatgaatgtgcacttcgtgcactgaaagaggatcgcaaa
cgcttcttatgtaaagcagttgaaaattacatcaactgcttattaagtggagaagaacat
gatatgtgggtatttcgactttgttctctctggcttgaaaactctggagttcctgaagtc
aatggcatgatgaagggacctggaatggagattccatcatacaaatttttgcctctaatg
taccaactggctgctagaatgggaaccaaaatgatgggaggagtgggatttcatgaagtc
ctcaataatctcatctctagagtttcgatggatcacccccatcatactttatttattata
ttggctttagcaaatgcaaacaaagatgaatttttgaccaaaccagaagcagcaaggagg
agtagaataactaaaaatgcacctaaacaaagctctcagcttgatgaggataggatggag
gctgcaaacaatataataagtaccatcagaagcaagaggcctcagatggtcaggagtgtt
gaagcactttgtgatgcttatattttgttagcaaacttggatgccactcagtggaagacc
cagagaaaaggcatcatcattcctgcagaccagccaattactaagcttaagaatttagaa
gctgttgttgtccctactatggaaattaaggtggatcccacaggagaatatgaaaacttg
gtgactatacagtcatttaaagcagaatttcgtttagcaggaggtataaatttaccaaaa
ataatagattgtgtaggctctgatggcagggaaaggagacagcttgttaagggacgtgat
gacctgagacaagatgctgtcatgcagcaggttttccagttgtgtaatatgttactgcaa
agaaacactgaaactaggaagaggaagttgactatctgcacatacaaggtggttcctctg
tctcagcgaagtggtgttcttgaatggtgcacaggaactatccctattggtgaatttctt
actgacagtgaaggtggtgctcataaaagatacaggccaacagatttcagttccgttcaa
tgccaaaagaaaatgatcgaaatacaaaagaagtcttttgaagagaaatacaaaaccttc
atgaatatctgcaagcattttcaaccagttttccgttacttctgcatggaaaaattcttg
gatccagctgtttggtttgagaaacgattggcttatactcgcagtgtggccacttcttct
attgttgggtacatacttggtcttggtgatagacatatacagaatatcttgataaatgag
cagtcagcagaactggtacatatagatttaggcgttgcatttgaacagggtaaaatactt
cctactcctgaaacagttccctttagactcaccagagatattgtggatggcatgggcatt
actggcgttgaaggtgttttcagaagatgctgtgagaaaacaatggaagtaatgagaaat
tctcaggaaactctgttaaccatagtggaggtcctgctgtatgatccactctttgactgg
accatgaatcctttgaaagctttgtatttacaacagaggcccgaagacgaaactgagttc
cagtccactcccaatgcagatgaccaagaatgcaaacggaatctgagtgacattgaccaa
agtttgaacaaagtggctgaacgtgtcttgataagacttcaggagaaactaaaaggagtg
gaggaaggcactgtgctcagtgtgagtggacaagtgaacttgcttatccagcaggccatg
gaccccaaaaatctcagccgacttttcccaggttggaaagcttgggtgtga

DBGET integrated database retrieval system