KEGG   Oryctolagus cuniculus (rabbit): 100349333
Entry
100349333         CDS       T03373                                 

Gene name
DDX39B
Definition
(RefSeq) DExD-box helicase 39B
  KO
K12812  ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100349333 (DDX39B)
  09122 Translation
   03013 RNA transport
    100349333 (DDX39B)
   03015 mRNA surveillance pathway
    100349333 (DDX39B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100349333 (DDX39B)
   03041 Spliceosome [BR:ocu03041]
    100349333 (DDX39B)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100349333 (DDX39B)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100349333 (DDX39B)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   EJC/TREX
    100349333 (DDX39B)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    100349333 (DDX39B)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1
Other DBs
NCBI-GeneID: 100349333
NCBI-ProteinID: XP_008260767
Ensembl: ENSOCUG00000024126
LinkDB
Position
12
AA seq 428 aa
MAENDVDNELLDYEEDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAI
VDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMC
HTRELXFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALA
RNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCR
KFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRC
IALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAF
NYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI
SSYIEQTR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggcagagaacgacgtggacaacgagctcttggactacgaggaggatgaggtggagaca
gcagctgggggagatggggctgaggcccctgccaagaaggacgtcaagggctcctacgtc
tccatccacagctctggcttccgggacttcctgctcaagccagagttgctccgcgccatt
gttgattgcggctttgagcatccatcagaagtccagcacgagtgcatccctcaggctatc
ctcggaatggatgtcctgtgccaggccaagtccggcatggggaagaccgcggtgtttgtg
ctggccacactgcagcagctggagccagttactgggcaggtgtctgtgctggtgatgtgt
cacactagagagctgngctttcagattagcaaggagtatgagcgcttctctaagtacatg
cccaatgtcaaggttgccgtgttttttggtggtctgtctatcaagaaggatgaagaggtg
ctgaagaagaactgcccgcatattgtcgtggggactcctggccgcatcctagccctggct
cggaacaagagcctcaacctcaaacacattaaacactttatcttggatgaatgcgacaag
atgcttgaacagctcgacatgcgtcgggatgtccaggaaatttttcgcatgaccccccac
gagaagcaggtcatgatgttcagtgctaccttgagcaaagagatccgtcccgtctgccgc
aagttcatgcaagatcctatggagatcttcgtggatgatgagacgaagttgacgctgcat
gggttgcagcagtactacgtgaaactgaaggacaacgagaagaaccggaagctctttgac
cttctggatgtccttgagttcaaccaggtggtgatctttgtgaagtctgtgcagcgctgc
attgctctggcccagctcctcgtggagcagaacttcccagctattgccatccaccgaggg
atgccccaggaggaaaggctttctcggtatcagcagtttaaagattttcaacgacgaatt
cttgtggctaccaacctgtttggtcgaggtatggacattgagcgggtgaacatagccttt
aactatgacatgcctgaggattctgacacctacctgcatcgggtggccagagcgggccgg
tttggcaccaagggtttggccatcacctttgtgtcagatgagaatgatgccaagatcctc
aatgacgtgcaggaccgctttgaggtcaacattagtgaactgcctgatgagatcgacatc
tcctcctatattgagcagacacggtag

DBGET integrated database retrieval system