KEGG   Oryctolagus cuniculus (rabbit): 100349354
Entry
100349354         CDS       T03373                                 

Gene name
CSTF1
Definition
(RefSeq) cleavage stimulation factor subunit 1
  KO
K14406  cleavage stimulation factor subunit 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100349354 (CSTF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100349354 (CSTF1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     100349354 (CSTF1)
SSDB
Motif
Pfam: WD40 CSTF1_dimer ANAPC4_WD40 Frtz Ge1_WD40
Other DBs
NCBI-GeneID: 100349354
NCBI-ProteinID: XP_008272371
Ensembl: ENSOCUG00000011351
LinkDB
Position
Un
AA seq 431 aa
MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMEN
DDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDG
QLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLA
FHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPT
LRLYDINTFQCFVSCNPQDQHTDAICSVNYNPSANMYVTGSKDGCIKLWDGVSNRCITTF
EKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAV
FNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR
ARFWYRRSTTD
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgtacagaaccaaagtgggcctgaaggaccgccagcagctgtacaagctcatcatcagc
cagctgctctatgacggctacatcagcatcgccaacggcctcatcaacgagatcaagccg
cagtcggtctgtgcgccctccgagcagctcctgcatctcatcaaactaggaatggaaaat
gatgataccgccgttcagtatgcgatcggccgatcagacacagttgcccctggcacaggg
atcgacctggaatttgatgcagatgtccagaccatgtccccagaggcttccgagtatgaa
acgtgctatgtcacatctcataagggaccgtgccgcgtggctacctatagtagagatggg
cagttgatcgccacgggctctgccgatgcctccataaagatacttgacaccgaaaggatg
ttggccaaaagtgccatgccgatagaggtcatgatgaatgagactgcacaacagaatatg
gaaaaccaccccgtgattcgaactctctacgaccatgtggatgaagtcacatgtctcgct
ttccacccaacagaacagatcctggcctctggctcgagggattatactctgaaattattc
gattattccaaaccatctgcaaaaagggccttcaaatatattcaggaagcggagatgttg
cgctccatctctttccacccttccggagacttcatcctcgtcggcactcagcaccccacc
ctccgcctgtatgacatcaacaccttccagtgctttgtgtcctgcaatcctcaagaccag
cacaccgacgccatatgctctgtcaattacaatcctagtgccaacatgtatgtgactggc
agcaaggacggctgcatcaagctgtgggatggagtctctaaccggtgcatcacgactttt
gagaaggcacatgatggggctgaagtttgctctgccattttttccaaaaattctaaatac
atcctctcaagtggaaaagactctgttgctaaactttgggaaatatcaacaggacgaacg
ctggtcagatacacgggtgcggggttgagtggccggcaggtgcaccggactcaggccgtg
ttcaaccacaccgaggactacgtgctgctgccggacgaaaggacgatcagtctctgctgc
tgggactcgaggacagccgagcggagaaacctgctctccttggggcacaacaacatcgtg
cgctgcatcgtgcactcgcccaccaaccccggcttcatgacgtgcagcgacgacttcaga
gcgcgcttttggtacaggaggtcgaccactgactga

DBGET integrated database retrieval system