KEGG   Oryctolagus cuniculus (rabbit): 100349426
Entry
100349426         CDS       T03373                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01523  Antifolate resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04218  Cellular senescence
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04917  Prolactin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04926  Relaxin signaling pathway
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05030  Cocaine addiction
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100349426 (NFKB1)
   04014 Ras signaling pathway
    100349426 (NFKB1)
   04064 NF-kappa B signaling pathway
    100349426 (NFKB1)
   04668 TNF signaling pathway
    100349426 (NFKB1)
   04066 HIF-1 signaling pathway
    100349426 (NFKB1)
   04071 Sphingolipid signaling pathway
    100349426 (NFKB1)
   04024 cAMP signaling pathway
    100349426 (NFKB1)
   04151 PI3K-Akt signaling pathway
    100349426 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100349426 (NFKB1)
   04218 Cellular senescence
    100349426 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100349426 (NFKB1)
   04621 NOD-like receptor signaling pathway
    100349426 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    100349426 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    100349426 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    100349426 (NFKB1)
   04660 T cell receptor signaling pathway
    100349426 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    100349426 (NFKB1)
   04659 Th17 cell differentiation
    100349426 (NFKB1)
   04657 IL-17 signaling pathway
    100349426 (NFKB1)
   04662 B cell receptor signaling pathway
    100349426 (NFKB1)
   04062 Chemokine signaling pathway
    100349426 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100349426 (NFKB1)
   04917 Prolactin signaling pathway
    100349426 (NFKB1)
   04926 Relaxin signaling pathway
    100349426 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100349426 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100349426 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    100349426 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349426 (NFKB1)
   05202 Transcriptional misregulation in cancer
    100349426 (NFKB1)
   05206 MicroRNAs in cancer
    100349426 (NFKB1)
   05203 Viral carcinogenesis
    100349426 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100349426 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100349426 (NFKB1)
   05221 Acute myeloid leukemia
    100349426 (NFKB1)
   05220 Chronic myeloid leukemia
    100349426 (NFKB1)
   05215 Prostate cancer
    100349426 (NFKB1)
   05222 Small cell lung cancer
    100349426 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100349426 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100349426 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100349426 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100349426 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100349426 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100349426 (NFKB1)
   04931 Insulin resistance
    100349426 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100349426 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100349426 (NFKB1)
   05135 Yersinia infection
    100349426 (NFKB1)
   05133 Pertussis
    100349426 (NFKB1)
   05134 Legionellosis
    100349426 (NFKB1)
   05152 Tuberculosis
    100349426 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349426 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    100349426 (NFKB1)
   05162 Measles
    100349426 (NFKB1)
   05164 Influenza A
    100349426 (NFKB1)
   05161 Hepatitis B
    100349426 (NFKB1)
   05160 Hepatitis C
    100349426 (NFKB1)
   05168 Herpes simplex virus 1 infection
    100349426 (NFKB1)
   05163 Human cytomegalovirus infection
    100349426 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100349426 (NFKB1)
   05169 Epstein-Barr virus infection
    100349426 (NFKB1)
   05165 Human papillomavirus infection
    100349426 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100349426 (NFKB1)
   05145 Toxoplasmosis
    100349426 (NFKB1)
   05140 Leishmaniasis
    100349426 (NFKB1)
   05142 Chagas disease
    100349426 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100349426 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100349426 (NFKB1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100349426 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_5 Ank_3 Death
Other DBs
NCBI-GeneID: 100349426
NCBI-ProteinID: XP_017202875
Ensembl: ENSOCUG00000021712
LinkDB
Position
15
AA seq 976 aa
MADDDHYLRGHEQMFHLDTLNPSLFGTELFQPGMPPPTADGPFLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICKYIGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVNAGPKDMVVSFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQT
EGGGDRQLTDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGAGSTGPGYGFPHYGFPTYGGISFH
PGTTKSNAGMNHGTIDSECKTDPGCCDKSDDRETINPSGKVIETTDQDKESDTSSDGSDE
AALMCTAEVKEENARFQDNLFLEKALELAKRHANALFDYAVTGDVKMLLAVQRHLTVVQD
ENGDSVLHLAIIHRHAQLGRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVQD
LLRAGADLSLLDRLGNSVLHLAAKEGQDQILSVLLKHKKAPLLIDHPNGEGLNAIHLAVL
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWETAGEDEGVVPGTTPLDMAA
SWQVFDILNGKPYEPEFTSDELMAQGDMRQLTEDAKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQADFGSAGTAAT
SPVKATSQVHSLPLSPSSTRQQLDELPDSDSVCDSGVETSFRRLSFTESLPSSGSMLTLH
KMPHEYGQEGPIEGKI
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggcagacgacgaccactatttgagaggacatgaacaaatgtttcatttggacactttg
aatccttcactatttggtactgaattatttcaacctgggatgccaccaccaacagcagat
ggcccattccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgtc
tgtgaaggcccatcccatggtggacttcctggcgcatctagtgagaagaacaagaagtcc
taccctcaggtcaaaatctgcaaatatattggacctgcaaaggttattgttcagttggtc
acaaatggaaaaaatatccacctgcatgcccacagcctggtgggaaaacactgtgaagat
gggatttgcaccgttaatgctggacccaaggacatggtggtcagctttgcaaacctgggt
atacttcatgtgacgaagaaaaaagtatttgaaacactggaagcacggatgacagaggca
tgcataaggggctataatcctggacttttggtgcatcctgatctggcttatttgcagaca
gaaggcggaggagaccggcagctcacggatcgggaaaaggagctcatccgtcaggcagct
ctgcagcagacaaaggagatggacctgagcgtggtgcggctcatgtttacagccttcctt
ccagacagcactggcagcttcaccaggcgcctggaacccgtggtatccgatgccatctat
gacagcaaagcccccaatgcatccaacttgaaaattgtgagaatggacaggacggctgga
tgcgtgactggaggggaagagatttatcttctgtgtgacaaagttcagaaagatgacatc
cagattcgattttatgaagaggaggaaaatggtggaatctgggaaggatttggagacttt
tcccccacagacgttcatagacagtttgccattgtcttcaaaactccaaagtataaagat
gtcaacattacaaaaccagcctctgttttcgtccaacttcggaggaaatctgatttggaa
actagtgaaccaaaaccttttctctactaccctgaaatcaaagataaagaggaagtgcag
aggaagcggcagaagcttatgcccaatttctcggacagtttcggaggtggcagtggtgcc
ggggcgggaggcggaggcatgtttggtagcggcggcggcggaggcggagctggaagcaca
ggcccagggtacggcttcccacactatggatttcctacctacggtggaatttcctttcat
cctggaaccactaaatctaatgctgggatgaaccatggaaccatagactccgaatgtaaa
actgaccctggatgttgtgacaagagtgatgacagagagaccataaatccctctggaaaa
gtaattgaaaccacagaccaagataaggaatctgacacatccagtgatgggagtgatgag
gccgcgctgatgtgcacagcagaagtgaaggaggagaatgctaggtttcaggataacctg
tttctagagaaggctctggagcttgccaagcggcatgccaatgccctcttcgactacgca
gtgacaggagatgtgaagatgctcctggctgtccagagacatctcactgtagtgcaggat
gagaatggggacagcgtcttacacctagcaatcatccaccgtcatgctcagctggggagg
gatctgctggaagtcacgtctggcttgatttctgacgacatcatcaacatgcgaaatgac
ctgtaccagacacccttgcacttggcagtgatcactaagcaggaagacgtggtacaggat
ttgctgcgagctggggcagacctgagtcttttggaccgcttgggcaactctgttttgcac
ctagctgccaaagaaggacaagaccaaattctcagtgtcttactcaagcacaaaaaggca
ccactacttattgaccatcccaatggggaaggtctgaatgccatccacctagccgtgttg
agcaatagcctgccgtgcctgctgctgctggtggccgctggggcggatgtcaatgcccag
gagcagaagtcggggcgcacggcactgcacctagctgtggaacatgacaacatctccttg
gccggctgcttgctcctggagggcgatgcccacgtggacagtaccacctacgatggaact
acacccctgcatatagcggctgggagaggatccaccagactggcagctcttctcaaagca
gcaggagcagatcccctggtggagaactttgagcctctctacgacttggacgactcttgg
gagacggctggagaggatgaaggagttgtgcctggaaccactcctctggatatggccgcc
agctggcaggtgtttgacatattaaatggaaaaccgtatgagccagagttcacatctgat
gagttaatggcacaaggagacatgagacagctgactgaagacgcaaagctgcagctctac
aaattgctagaaattcccgatccagacaaaaactgggctactctggcacagaaattaggc
ctggggatacttaacaatgccttccggctgagtcctgctccttctaaaactcttatggac
aattacgaggtctctggtgggacagtcagagagctggtggaggccttgagacagatgggc
tacaccgaagccatcgaagtgatccaggcggacttcggcagcgcgggaaccgcagccacg
agccccgtgaaagccacctcccaggtgcactcgctgcctctgtcgccgtcttccacaagg
cagcagctagatgagctgccagacagcgacagcgtctgtgacagcggcgtggagacgtca
ttccgcagactcagcttcacggagtccctccccagcagcggctcgatgctaactcttcac
aaaatgccccacgagtacgggcaagaaggacctatcgaaggcaaaatctag

DBGET integrated database retrieval system