KEGG   Oryctolagus cuniculus (rabbit): 100350176Help
Entry
100350176         CDS       T03373                                 

Gene name
ELOVL1
Definition
(RefSeq) ELOVL fatty acid elongase 1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00062  Fatty acid elongation
ocu01040  Biosynthesis of unsaturated fatty acids
ocu01100  Metabolic pathways
ocu01212  Fatty acid metabolism
Module
ocu_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100350176 (ELOVL1)
   01040 Biosynthesis of unsaturated fatty acids
    100350176 (ELOVL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ocu01004]
    100350176 (ELOVL1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100350176 (ELOVL1)
Lipid biosynthesis proteins [BR:ocu01004]
 Elongase
  PUFA
   100350176 (ELOVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 100350176
NCBI-ProteinID: XP_008263633
Ensembl: ENSOCUG00000011349
LinkDB All DBs
Position
13
AA seq 314 aa AA seqDB search
MRKWQAGWPWGLLSGPAPSEPSIAARLAPTEFFARMEAVVNLYHEMMKHADPRMQGYPLM
GSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGW
LSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELIDTVIFILRKKDGQVTFLHVFHH
SVLPWSWWWGVKVAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQ
LIQFVLVSLHISQYYFMPSCNYQYPVIIHLIWMYGTIFFVLFSNFWYQSYTKGKRLPRAL
QQNGAPGIAKVKAN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtggcaggcaggctggccctggggactcctctctggtcctgctccctccgag
ccctccatcgctgcccgcctggcccctactgagttcttcgccaggatggaggctgttgtg
aacttgtaccatgagatgatgaagcatgcagatccccggatgcagggctaccctctgatg
gggtcccccctgctgatgacttccattctcctgacctatgtgtactttgtcctctcactg
gggcctcgcatcatggccaatcggaagcccttccagctacgtggcttcatgattgtctac
aacttctccctggtggcactctctctatacatcgtctatgagttcctgatgtctggctgg
ctgagcacttatacctggcgttgtgaccccgtggactactccaacagccctgaggctctc
aggatggttcgagtggcctggctcttcctcttctctaagttcattgagctgatagacacg
gtgatctttatcctccggaagaaagacgggcaggtgaccttcctccatgtcttccatcac
tcagtgctcccctggagctggtggtggggggtaaaggtggccccaggagggatgggctct
ttccacgccatgatcaactcctccgtgcatgtggtcatgtacctgtactatgggttgtct
gccctcggccctgtggcgcagccctacctctggtggaaaaagcatatgacggccattcag
ctgatccagtttgtcctggtctcgctgcacatctcccagtactacttcatgcccagctgc
aactaccagtacccagtcatcatccacctcatctggatgtatggcaccatcttctttgtg
ctcttctccaatttttggtatcagtcttacaccaagggcaagcggctgccccgtgcacta
cagcaaaatggagctccaggtatcgccaaggtcaaggccaactga

DBGET integrated database retrieval system