KEGG   Oryctolagus cuniculus (rabbit): 100350312
Entry
100350312         CDS       T03373                                 

Gene name
CLP1
Definition
(RefSeq) cleavage and polyadenylation factor I subunit 1
  KO
K14399  polyribonucleotide 5'-hydroxyl-kinase [EC:2.7.1.78]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100350312 (CLP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100350312 (CLP1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.78  polynucleotide 5'-hydroxyl-kinase
     100350312 (CLP1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor IIm (CFIIm)
     100350312 (CLP1)
SSDB
Motif
Pfam: CLP1_P CLP1_N Clp1 ATP_bind_1 MMR_HSR1 AAA_18 TniB AAA_22 CbiA AAA_16
Other DBs
NCBI-GeneID: 100350312
NCBI-ProteinID: XP_002709210
Ensembl: ENSOCUG00000007045
LinkDB
Position
1
AA seq 438 aa
MEKSKARHSYSERMGEETNDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGT
ELTRNKKFTFDAGAKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQA
EKEEERGPRVMVVGPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALY
IERPADVEEGFSIQAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCV
INTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVE
RSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQED
NQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPR
PLPKNFLLIMDIRFMDLK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggagaaaagtaaagcaaggcacagctactcagaaaggatgggagaggagaccaatgat
gacaagaagccgacgacgaaattcgaactcgagcgagaaacagagctccgctttgaggtg
gaagcgtctcagtcggttcagctggagctgttgaccggcatggcagagatctttggcacg
gagctgacccggaacaagaaattcaccttcgacgctggtgccaaggtggccgttttcacg
tggcatgggtgttctctgcaactgagcggccgcacggaggtggcctacgtctccaaggac
acccccatgttgctttacctcaacactcacacagccctggagcagatgcggaggcaagcg
gagaaggaagaagagcgaggtccccgagtgatggtcgtgggccccaccgacgtgggcaag
tccacggtgtgccgcctgctgctcaactacgccgtgcgtttgggccgccgtcccacttac
gtggagctggatgtgggccagggatctgtgtccatccccggcactatgggggcgctctac
attgagcggccagcggatgtggaagagggtttctctatccaggcccctctggtctatcat
tttggctccaccacgcctggcaccaacatcaagctgtataataagattacatctcgatta
gcagatgtgttcaaccagaggtgtgaggtcaaccgaagagcatctgtgagtggctgcgtc
attaacacctgtggctgggtcaagggctctggttaccaggccctggtacatgcagcttca
gcatttgaggtggatgtagtcgtggtgctggatcaagaacgactgtacaatgaactgaaa
cgcgacctgccccactttgtacgcacagtactgctcccgaaatcagggggcgtggtggag
cgctccaaagatttcaggcgggaatgcagggatgagcgtatccgtgagtacttctatgga
ttccggggttgcttctatccccacgccttcaatgtgaagttttcagatgtgaaaatctac
aaagttggggcacccaccatcccagattcctgtctgcctttgggcatgtcccaggaggac
aatcagctcaagctagtgcccgtcacacctggccgagatatggtgcaccacctcctgagt
gtgagcactgcggagggcacagaggagaacctttccgagaccagcgtggccgggttcatt
gtggtgaccagtgtggacctggagcatcaggtgtttactgtcctttctccagctccccgc
ccactgcctaagaacttcctcctcatcatggatatccggttcatggatcttaagtag

DBGET integrated database retrieval system