KEGG   Oryctolagus cuniculus (rabbit): 100350430
Entry
100350430         CDS       T03373                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04115  p53 signaling pathway
ocu04145  Phagosome
ocu04151  PI3K-Akt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04510  Focal adhesion
ocu04512  ECM-receptor interaction
ocu05144  Malaria
ocu05165  Human papillomavirus infection
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100350430 (THBS1)
   04350 TGF-beta signaling pathway
    100350430 (THBS1)
   04151 PI3K-Akt signaling pathway
    100350430 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100350430 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100350430 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100350430 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100350430 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100350430 (THBS1)
   05205 Proteoglycans in cancer
    100350430 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100350430 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100350430 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100350430 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350430 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100350430 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100350430 (THBS1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100350430 (THBS1)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100350430 (THBS1)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   100350430 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 TSP1_ADAMTS EGF_CA TSP1_CCN Laminin_G_3 Laminin_G_2 EGF Laminin_G_1
Other DBs
NCBI-GeneID: 100350430
NCBI-ProteinID: XP_002717845
Ensembl: ENSOCUG00000003792
UniProt: G1SKF1
LinkDB
Position
17
AA seq 1171 aa
MGLAWGLSVLFLLQVCGSNHIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAYR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLFLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGHWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLANVARLRIAKGGVNDNFQGALQNVRFVFGTTPEDILRNKGCSSASTNVL
LTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSNIFLELRGLRTIVTTLQDSIR
KVTEENKELANELRKPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCS
NATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQ
TRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEAR
ETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPVPQFGGKDCVGDVTENQ
ICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDAC
FNHNGEHRCKNTDPGYNCLPCPPRYTGTQPFGRGVEHAMAHKQVCKPRNPCTDGTHDCNK
NAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCP
NLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPY
NHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLE
HNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDD
NDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRR
FQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNA
LWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIY
DKTYAGGRLGMFVFSQEMVFFSDLKYECRDS
NT seq 3516 nt   +upstreamnt  +downstreamnt
atggggctggcctggggactcagtgtcctgttcctgctgcaggtgtgtggcagcaaccac
attccagaatctgggggagacaacagcgtgtttgacatctttgaactcaccggggctgcc
cgcaagggctctgggcgccggctcgtgaagggtcctgacccttccagccctgcttaccgc
atcgaagatgccaacctgatccccccggtgcctgacgacaagttccaggacctagtggat
gctgtgcgcgcagagaaaggtttcctcttcctggcctccctgaggcagatgaagaagacc
cggggcacgctgctggctttggagcggaaagaccactctggccaggtcttcagtgtggtc
tccaacggcaaggcgggcaccctggacctgagcctgaccgtgcaggggaagcagcatgtg
gtgtcggtggaggaagctctgctggcgaccggccactggaagagcatcaccctgtttgtg
caggaagacagggcccagctgtacatcgactgcgagaagatggagaatgctgagctggac
gtccccatccagagcatcttcaccagggacttggccaacgtggccaggctccgcatcgcc
aagggaggcgttaatgacaacttccagggggcactgcagaatgtgcggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagtgcatccaccaatgtcctt
ctcacccttgacaacaatgtggtgaacgggtccagccctgccatccgcactaactacatt
ggccacaagacaaaggacctgcaggccatctgtggcatctcctgtgatgagctgtccaac
atattcctggaactcaggggcctgcgcaccatcgtgaccacgctgcaggacagcattcgc
aaagtgactgaagagaacaaagagctggccaatgagctgaggaagcctcccctctgctat
cacaatggggtccagtacaggaataacgaggaatggaccgtggacagctgcactgagtgt
cgctgtcagaactcagtcaccatctgcaaaaaggtgtcctgccccattatgccctgctcc
aatgccacagttcctgatggagaatgctgcccgcggtgttggcccagtgactcagcagat
gatggctggtctccgtggtctgagtggacctcttgctctgtgacatgtggcaatggaatt
cagcagcgtggccgctcctgtgacagcctcaacaaccgatgcgagggctcctcggtccag
acgcggacctgccacatccaggaatgtgacaagagatttaaacaggacggcggctggagc
cactggtccccgtggtcatcctgttctgtgacatgtggagatggtgtgatcacaaggatc
cggctctgcaactctcccagcccccagatgaatgggaaaccatgtgaaggcgaagctcgg
gagaccaaggcctgcaagaaagatgcctgccccatcaatggcggctggggtccttggtct
ccatgggacatctgttctgtcacctgtggaggaggggtgcagaaacgaagccggctctgc
aacaaccccgtgccccagtttggaggcaaggactgcgttggtgatgtgacagaaaaccag
atctgcaacaagcaggactgtccaatcgatggatgtctgtccaatccctgctttgccggt
gtcaagtgtactagctaccctgacggcagctggaaatgcggtgcttgtccccctgggtat
agtggcaatggcatccagtgcaaagatgtcgatgagtgcaaagaagtgcctgacgcctgc
ttcaaccacaacggggagcacaggtgtaagaacacagaccctggctacaactgcctgccc
tgccctccacgctacactggcacgcagcctttcggaaggggtgttgaacatgccatggcc
cacaaacaggtgtgcaaaccacgcaacccctgcacagatgggacacatgactgcaacaag
aatgccaagtgtaactacctgggccactacagtgaccccatgtaccggtgtgagtgcaag
cctggctatgctggcaatggcatcatctgtggggaggacacagacctcgatggctggcct
aatgagaacctggtgtgtgtggccaacgcaacttaccactgcaaaaaggataactgcccc
aacctccccaactcggggcaggaagactatgacaaggatggaatcggagatgcctgtgat
gatgacgatgacaatgacaaaatcccagatgatagggacaactgtccgttccattacaac
ccagcccagtatgactatgaccgagatgatgtgggtgaccgctgtgacaactgcccctac
aaccacaatccagaccaggcagacacagacaacaacggggaaggagatgcctgtgctgca
gacattgatggggatggtatactcaatgaacgagacaactgccagtatgtctacaatgtg
gaccagagggacactgacatggatggggttggagatcagtgtgacaactgccccctggaa
cacaatcccgatcagctggactctgactcggatcgcattggagacacctgtgacaacaat
caggatattgatgaagatggccaccagaacaatttggacaactgtccctatgtgcccaat
gccaaccaggctgaccacgataaagatggcaagggggacgcctgtgaccatgatgatgac
aatgacggcattcctgacgacagggacaactgcagacttgtgcccaatcctgaccagaag
gactctgatggtgatggtcgaggtgatgcttgcaaagatgattttgaccatgacaacgtg
ccagacatcgatgacatctgtcctgagaatgttgacatcagtgagactgacttccgccgg
ttccagatgattcctctggaccccaaggggacatcccaaaatgatcctaactgggttgta
cgccatcagggtaaagaactcgtccaaactgtcaactgtgatcctggacttgccgtaggt
tatgatgaatttaacgctgtggacttcagtggcaccttcttcatcaacactgaaagggat
gatgactatgctggatttgtgtttggctaccagtctagcagccgcttctatgttgtgatg
tggaagcaagtcacccaatcctactgggacaccaaccccacgagggctcagggatactca
ggcctctctgtgaaggttgtgaactccaccacagggcctggtgagcacctgaggaatgca
ctgtggcacacaggaaacactcctggccaggtgcgtaccctgtggcatgaccctcgtcac
ataggctggaaagatttcactgcttacagatggcgtctcagccacaggccaaagacaggt
ttcattagagtggtaatgtatgaaggaaagaaaatcatggctgactcaggccccatctat
gacaaaacctatgctggcggtagactagggatgtttgtcttctctcaagaaatggtgttc
ttctctgacttgaagtacgaatgtagagattcctaa

DBGET integrated database retrieval system