KEGG   Oryctolagus cuniculus (rabbit): 100350501
Entry
100350501         CDS       T03373                                 

Gene name
PERP
Definition
(RefSeq) PERP, TP53 apoptosis effector
  KO
K10136  TP53 apoptosis effector
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100350501 (PERP)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100350501
NCBI-ProteinID: XP_002714891
Ensembl: ENSOCUG00000004238
UniProt: G1SLD2
LinkDB
Position
12
AA seq 193 aa
MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCLGEGGGSGS
YEEGCQSLMEYAWGRAAAAMLFCGFIILVICFVLSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQTFNLHLNPAVTYIFNWAYGFGWAATIILIGCAFFFCCLPNYEDDL
LGNAKPRYFYTSA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgctgcgctgcggcctggcctgcgaacgctgcaggtggatcctgcccctgctcctgctc
agcgccatcgccttcgacatcatagcgctggccggccgaggctggctgcagtcgagcgac
catggccagacgtcctcgctctggtggaaatgcctgggcgagggcggcggcagcgggtcc
tacgaggaaggatgccagagcctcatggagtacgcgtggggacgggcggcggccgccatg
ctcttctgcggatttatcatcctcgtcatctgcttcgtgctgtccttcttcgccctctgc
ggaccccagatgctggtcttcctcagagtgatcgggggcctcctcgccctggctgctgtg
ttccagatcatctcgctggtaatttacccagtcaagtacacccagaccttcaaccttcat
ctcaaccctgctgtcacgtacatctttaactgggcctatggctttgggtgggcagccacg
atcatcctgattggctgtgccttcttcttctgctgtctccccaactacgaggatgacctg
ctgggcaatgcgaagcccaggtacttctacacctcagcctaa

DBGET integrated database retrieval system