KEGG   Oryctolagus cuniculus (rabbit): 100350564
Entry
100350564         CDS       T03373                                 

Gene name
RPRM
Definition
(RefSeq) reprimo, TP53 dependent G2 arrest mediator candidate
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100350564 (RPRM)
SSDB
Motif
Pfam: Tmemb_9 CobS
Other DBs
NCBI-GeneID: 100350564
NCBI-ProteinID: XP_002712227
Ensembl: ENSOCUG00000001688
UniProt: G1SFX3
LinkDB
Position
7
AA seq 109 aa
MNPALSNQTDLAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaatccggcgctgagcaaccagaccgacttggcgggcctgttcctggccaacagcagc
gaggcactggagcgcgcggtgcgctgctgcacccaggcgtccgtggtgaccgacgacggc
ttcgccgagggcggcccggacgaacgcagcctgtacatcatgcgcgtggtgcagatcgcg
gtcatgtgcgtgctctcgctcaccgtggtcttcggcatcttcttcctcggctgcaacctg
ctcatcaagtccgagggcatgatcaacttcctggtgaaggaccggagaccgtcgaaagaa
gtggaggcggtggtcgtggggccctactga

DBGET integrated database retrieval system