KEGG   Oryctolagus cuniculus (rabbit): 100350583
Entry
100350583         CDS       T03373                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100350583 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100350583 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 100350583
NCBI-ProteinID: XP_002717143
Ensembl: ENSOCUG00000008388
LinkDB
Position
15
AA seq 343 aa
MKDLGVEYLADRKGVQLLGLLNLYLDQEQRFQPREKGLSLIEATPENDNTLCPRLRNAKV
EDLRSLTNFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCCFLLAARIVEEECNVP
STHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHTILLCHTSERKESL
NLDKLEAQLKACSCRLVFSKAKPSVLALCLLNLEVETLKSVDLLEILLLVKKHSKINDTE
FFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
ESESEDSGEDMSSGEESLSSSPSDQECTFFFNLTVAQTLCFPS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaggatctgggggtagagtacttggcagatcggaaaggagttcagctccttggattg
ttgaacctgtacctggatcaagaacaaagattccagcctcgagagaaagggctgagcttg
atcgaggccacgccggagaatgataacactttgtgtccaagattgagaaatgccaaagta
gaagacttaaggagtttgactaacttttttggatcttgcactgaaacctttgtgctggct
gtcaatattttggacagattcttggctcttatgaaggtgaaacctaaacatttgtcttgc
attggagtgtgttgttttttgctggctgctagaatcgttgaagaagaatgcaacgttcca
tccactcatgatgtaatccggattagtcagtgtaaatgcactgcctctgacataaagcgg
atggaaaagatcatttcagagaaattgcactatgaattggaagctactactgccttaaac
tttttgcacttataccataccattctactttgtcacacttcagaaaggaaagaaagcctg
aacctcgataagctagaagcccagctgaaagcttgcagctgccgactcgtcttttcaaaa
gctaaaccatcagtattagctttgtgccttctcaatttggaagtagaaactttgaaatct
gttgacttactggaaattctcctgcttgttaaaaaacattccaagataaatgacacggag
ttcttttactggagggagttagtctctaaatgcctagctgagtattcctctcctgaatgc
tgcaaacccgatctcaagaagttggtttggatcgtgtccaggcgcacagcccagaacctg
cacaacagctactacagtgtgcccgagctgcccaccatcccggagggcggctgtttcgac
gagagtgagagtgaggactctggtgaagacatgagtagcggagaagagagcctcagcagt
tctcccagcgatcaagagtgcaccttctttttcaacctcacagtggcgcagacgctgtgc
ttcccgtcctag

KEGG   Oryctolagus cuniculus (rabbit): 100357563
Entry
100357563         CDS       T03373                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin G1
  KO
K10145  cyclin G1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100357563 (CCNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100357563 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 100357563
NCBI-ProteinID: XP_002710403
Ensembl: ENSOCUG00000002129
UniProt: A0A5F9DG99
LinkDB
Position
3
AA seq 295 aa
MIEVLTTTDSQKLLHQLNTLLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLIQENLPFERRNNLNFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQQCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRIAHLPTIPEMVP
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatagaagtactgacaacaactgactctcagaaactgctacaccagctgaacactttg
ttggaacaggagtctagatgtcagccaaaggtctgcggcttgagactaattgagtctgca
cacgataatggcctcagaatgactgcacggctgagggacttcgaagtgaaagatcttctt
agtctcactcagttttttggctttgacacggagacattttctctagctgtgaatttactg
gacagattcctgtctaaaatgaaggtacagcccaagcaccttggatgtgttggtctgagc
tgtttttatttggctgtaaaatcaatagaagaggaaaggaatgtgccactggcaactgac
ttgatccggataagtcagtataggtttacggtttcagacttgatgagaatggaaaagatt
gtattggagaaggtgtgttggaaagtcaaagctactactgcctttcagtttctgcaactc
tattattcactcattcaagagaacttgccatttgaaaggagaaataaccttaattttgaa
agactggaagctcaacttaaggcatgtcactgcaggatcatattttctaaagcaaagcct
tctgtgttggctttgtctatcattgcattggagatccaagcacagcagtgtgtggagtta
acagaaggaatagaatgtcttcagaaacattccaagataaatggcagagatttgaccttc
tggcaagagcttgtatcaaagtgcttaactgagtattcatcaaacaagtgttcaaaaccg
aatgttcagaagttgaaatggattgtgtctgggcgtaccgcacggcaattgaagcatagt
tactacagaatagctcaccttccaacaattcctgaaatggttccttaa

DBGET integrated database retrieval system