KEGG   Oryctolagus cuniculus (rabbit): 100351032Help
Entry
100351032         CDS       T03373                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04210  Apoptosis
ocu04380  Osteoclast differentiation
ocu04625  C-type lectin receptor signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100351032 (MAP3K14)
   04064 NF-kappa B signaling pathway
    100351032 (MAP3K14)
   04668 TNF signaling pathway
    100351032 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100351032 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100351032 (MAP3K14)
   04660 T cell receptor signaling pathway
    100351032 (MAP3K14)
   04672 Intestinal immune network for IgA production
    100351032 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    100351032 (MAP3K14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    100351032 (MAP3K14)
   05169 Epstein-Barr virus infection
    100351032 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100351032 (MAP3K14)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100351032 (MAP3K14)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  Other
   100351032 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 100351032
NCBI-ProteinID: XP_002719233
Ensembl: ENSOCUG00000002640
UniProt: G1SHZ7
LinkDB All DBs
Position
19
AA seq 923 aa AA seqDB search
MAVMETACPGTPGSAVGQQKELAQAKEKTQSLGKKQSSLLHLEAVEKSPVFCGKWEVLND
VITKGTAKEGSGGGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSEGLDQIPNN
VAHATEGRTARVCWKGKRRSKARKKRKKKKSSKSPAQAGVALAKPCPRTPEQESCTVPVQ
EDESPLGTPYIRSSPQFTKPLREPGLGQLCFKKLGEDLRPALPRSELHKLISPLQCLNHV
WKLHHPQDVGPLPQLAHPFPYSRLPHPFPFCPLQPRKAQPLESFVLGKLACADSQQPLPG
PPLEPSYTAHSAQEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTWSTAGSQPRKPSPETE
DCEGVLLTEKLKPLDYEYREEVHWATHQPRLGRGSFGEVHRMEDKQTGFQCAVKKVRVEV
FRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQKGCLPEDRALYY
LGQALEGLEYLHSRRILHGDVKADNVLLSSDGSRAALCDFGHAVCLQPDGLGKSLLTGDY
IPGTETHMAPEVVTGRPCDTKVDVWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPV
REIPPSCAPLTVQAIQEGLRKEPIRRASATELGGQVSRALQQVGGLQSPWRGDYREPRPP
PPNQAGYQEALHAQPRELSSGDTTGGAPELQPLPPEPPEPNKSPTLNLSEEESGTWEPLP
LSSLDPSPGRNPSSPERKTTFPEQELQQLEIELFLNSLSQPFSLEEQEQILSCLSVDSLS
LSDDSEKNPSKASQSSRDTLSSGVHSWGSQAEARSSSWNMVLARGRPTDTPSYFNGVKVQ
IQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFSLVTKDGQPVRYDMEVPDSGIDLQC
TLAPDGSFAWSWRVKHGQLENRP
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaacagcctgcccgggcacccctggctctgcagttgggcagcagaag
gagctcgcccaagccaaggagaagacacagtctctggggaagaagcagagctccctcctc
catctcgaggccgtggagaagagccctgtgttctgcgggaagtgggaggtcctaaatgac
gtgattaccaagggcacagccaaggaaggctccgggggcgggccagccgccatctccatc
atcgcccaggctgaatgtgagaacagccaggagttcagccccaccttttcagaacgcatt
ttcatcgcagggtcaaaacagtacagccagtctgagggccttgatcagatccccaacaat
gtggcccacgcaaccgagggcagaacagcccgtgtgtgctggaagggaaagcgtcgcagc
aaagcccgcaagaaaaggaagaagaagaagagctcaaagtccccggcacaggcaggagtg
gccttagccaaaccctgcccccgaacccctgagcaggagagctgcacagtccccgtgcag
gaggatgagtctccattgggcaccccgtatattagaagcagcccccagttcaccaaacct
ctgagggaaccaggccttggccaactctgttttaagaaacttggtgaggacctacggccg
gcactgcctcgatcagaacttcacaaactgatcagccccttgcaatgtctgaaccacgtg
tggaagctccaccacccccaggacgtggggcccctgccccagctggctcaccctttcccc
tacagcagactgccccaccccttccctttctgccctctccagccacggaaagctcagccc
ctggagtcctttgtcctgggcaaactagcctgtgcagacagccagcagcccctgcctggc
ccacccctggagcccagctacacagctcatagcgcccaggagaagttctcggtggaggaa
tacctggtccacgctctgcaaggcagcgtgagctcgggccaggcccacagcctgaccagc
ctggctaagacctggtcaacagcaggatcccagccccggaagcccagccccgaaactgag
gactgcgagggagtcctgcttacagagaaactcaagccactggactacgagtaccgggaa
gaagtgcactgggccacacaccagccccgcctgggcaggggctcctttggagaggtccat
aggatggaggacaagcagaccggcttccagtgtgctgtcaaaaaggtacgagtcgaggtg
ttccgggcagaggaattgatggcttgtgcggggctgacctcacccagaatcgtccccctg
tatggagccgtgagagaaggcccatgggtcaatatcttcatggagctgctagaaggcggc
tcgctgggccagctcatcaagcagaagggctgtctgccggaggaccgggccctctactac
ctgggccaggccttggaggggctggaatacctgcattcacgaaggattctgcacggagat
gtcaaagctgacaacgtgctcctgtccagtgatgggagccgtgcggccctctgtgacttt
ggccatgccgtgtgccttcagcccgatggcctggggaagtccttgctcacaggggactac
atccctggcacggagacccacatggccccagaggtggtgacgggtcggccctgcgacacc
aaggtggacgtgtggagcagctgctgcatgatgctgcacatgctcaacggctgccaccct
tggacccagtacttccgagggcccctctgcctcaagattgccagtgaacctccaccagtg
agggagatcccaccctcctgtgcccccctcacggtccaggccatccaagaggggttgagg
aaagagcccatccgccgagcgtccgccacagagctgggggggcaggtcagccgggcgctg
cagcaagtgggcggtctgcagagcccctggaggggagactatagagaaccaaggcctccc
ccgccaaaccaagctggctatcaggaggccctgcatgcccagcccagggagctctcatcg
ggggacaccacaggtggggctcctgagctccagcctctaccaccagagcccccagagccg
aacaagtctccaaccctgaacctgagcgaggaggagtctggcacatgggaacccttgcct
ctgtcctccctggacccaagccccggcagaaaccccagctcaccagagcggaagaccacc
ttccccgagcaggagctgcagcagctggaaatagaactgtttctgaacagcctgtctcag
ccattttccctggaggagcaggaacaaattctctcgtgcctcagcgtcgacagcctctcc
ttgtcagatgacagcgagaagaacccatcgaaggcctctcagagctcacgagacaccctg
agttctggtgtgcactcgtggggcagccaggcagaggctcggagctccagctggaacatg
gtgctggcccgggggcggcccactgacaccccgagctactttaacggtgtgaaagtccaa
atacagtctctcaatggcgaacacctgcacatccgagagtttcaccgggtcaaggtggga
gacattgcaactggcatcagcagccagatcccagccgcagccttcagcttggtgaccaaa
gacgggcagcctgttcgctatgacatggaggtgccagactcgggcatcgacctgcagtgc
accctggcccccgatggcagcttcgcctggagctggagggtcaagcacggccagctggag
aacaggccctag

DBGET integrated database retrieval system