KEGG   Oryctolagus cuniculus (rabbit): 100351058
Entry
100351058         CDS       T03373                                 

Gene name
TRPV4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04218  Cellular senescence
ocu04750  Inflammatory mediator regulation of TRP channels
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100351058 (TRPV4)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100351058 (TRPV4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100351058 (TRPV4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100351058 (TRPV4)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100351058 (TRPV4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 100351058
NCBI-ProteinID: XP_008251141
Ensembl: ENSOCUG00000004269
LinkDB
Position
Un
AA seq 871 aa
MADPSDSPRAGPGEAAEPPGDESSTAGGEAFPLSSLANLFEGEDGSPAPLPADAGRPAGP
GDARPNLRMKFQGAFRKGVPNPIDLLESTLYESSVAPAPKKAPMDSLFDYGTYRHHPSDN
KRWRRKVVEKQPQSPKAPAPQPPPVLKVFNRPILFDIVSRGSTADLDGLLPFLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPALLDIAERTGNMREFINAPFRDIYYRGQT
ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPDS
NLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLWDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDFLRLAGEIITLLTGVLFFLTSIKDCHEKCPGVN
SLFVDGSFQLLYFIYSVLVIVSAALYLAGLEAYLAVMVFALVLGWMNALYFTRGLKLTGT
YSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLTPCANMKVCDEGQSNCTTPTYPSCR
DSETFSTFLLDLFKLTIGMGDLEMLGSAKYPVVFIILLVTYIILTFVLLLNMLIALMGET
VGQVSKESKHIWKLQWATTILDIERSFPVFVRKAFRSGEMVTVGKSSDGSPDRRWCFRVD
EVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELKNNSNPDEV
VVPLAHVGNPSGPGHQQSHPRKWRTDDAPAL
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggcggatcccagcgacagcccccgtgcagggcctggggaggcggctgagccccccggg
gatgaaagcagcaccgctggtggggaggccttccccctctcctcgctggccaacctgttc
gagggggaggatggctccccggcgcccttgcccgcggatgccgggcgccccgctggtcct
ggtgacgcacggcccaacctgcgcatgaagttccagggcgccttccgcaagggggtgccc
aaccccatcgacctgctggagtccaccctgtatgagtcctcggtggcgccggcgcccaag
aaagcacccatggactcgctctttgactatggcacctatcgtcaccaccccagtgacaac
aagcggtggaggaggaaggttgtagagaagcagccacagagccccaaggctcccgcaccc
cagccgccccctgtcctcaaagtcttcaaccggcccatcctcttcgacatcgtgtcccgg
ggctccactgccgacctggatgggctgctccccttcctgctgactcacaagaagcgcctc
acggacgaggagttccgggagccgtccacggggaagacctgcctgcccaaggccctgctg
aacctgagcaacggccgcaacgacaccatccccgcgctgctggacatcgccgagcggacc
ggcaacatgcgcgagttcatcaacgcgccctttcgcgacatctactaccgaggtcagacc
gccctgcacatcgccatcgagcgccgctgcaaacactacgtggagctgctggtggcccag
ggagccgacgtgcacgcccaggcccgcggccgcttcttccagcccaaggacgaggggggc
tacttctactttggggagctgcccctgtcgctggccgcctgcaccaaccagccgcacatc
gtcaactacctgacggagaacccgcacaagaaggcggacatgcggcgccaggattcgcgc
ggcaacaccgtgctgcacgcgctcgtggccatcgctgacaacacccgcgagaacaccaag
ttcgtcaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagc
aacctggaggccgtgctcaacaacgacgggctctcgcccctcatgatggccgccaagacg
ggcaagattgggatctttcagcacatcattcggcgggaggtgacggacgaggacacgcgg
cacctgtcgcgcaagttcaaggactgggcctatggccccgtctactcttcgctgtatgat
ctctcgtccctggacacatgtggggaagaggcctccgtgctggaaatcctggtgtataac
agcaagatcgagaaccgccacgagatgctggccgtggagcccatcaatgaactcctgtgg
gacaagtggcgcaagtttggagcggtctcgttctacatcaacgtggtctcctacctgtgc
gccatggtcatcttcaccctcaccgcctactaccagccgctggagggcactccgccatac
ccttaccgcaccacggtggacttcctgcgtctggccggcgagatcatcactctgctcacc
ggggtcctgttctttctcaccagcatcaaagactgtcatgagaagtgccctggagtgaac
tccctcttcgtggatggctccttccagctgctctacttcatctactccgtgctggtcatc
gtctccgcggccctctacctggcggggctcgaggcctacctggccgtgatggtctttgcc
ctggtcctgggctggatgaacgccctgtatttcactcgcgggctgaaactcacaggcacc
tacagcatcatgatccagaagatcctcttcaaagacctcttccgcttcctgctcgtctac
ctgctcttcatgatcggctacgcctcagccctggtctccctgctgacgccctgcgccaat
atgaaggtgtgcgacgaggggcagagcaactgcaccacgcccacctacccctcgtgccgc
gacagcgagacgttcagcaccttcctcctggacctcttcaagctcaccatcggcatgggc
gacctggagatgctgggcagcgccaagtaccccgtggtcttcatcatcctgctcgtcacc
tacatcatcctcaccttcgtcctgctgctcaacatgctcatcgccctcatgggggagacg
gtgggccaggtgtccaaggagagcaagcacatctggaagctgcagtgggccaccaccatc
ctggacattgagcgctccttccccgtgttcgtgcggaaggccttccgctccggggagatg
gtgaccgtgggcaagagctcggacggcagcccggaccgcaggtggtgtttcagggtggat
gaggtgaactggtctcactggaaccagaacttgggcatcatcaacgaggacccgggcaag
aatgagacgtaccagtactacggcttctcgcacactgtgggccgcctccggagggaccgc
tggtcctctgtggtgccccgcgtggtggagctgaagaacaattcaaacccggacgaggtc
gtggtgccactcgctcacgtggggaaccccagtggccctggccaccagcagagtcacccc
cgcaagtggcggactgatgatgcccccgccctctag

DBGET integrated database retrieval system