KEGG   Oryctolagus cuniculus (rabbit): 100351096
Entry
100351096         CDS       T03373                                 

Gene name
CALCOCO2
Definition
(RefSeq) calcium binding and coiled-coil domain 2
  KO
K21348  calcium-binding and coiled-coil domain-containing protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04137  Mitophagy - animal
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100351096 (CALCOCO2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100351096 (CALCOCO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351096 (CALCOCO2)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100351096 (CALCOCO2)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Xenophagy
   Cargo receptors
    100351096 (CALCOCO2)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    100351096 (CALCOCO2)
SSDB
Motif
Pfam: SKICH bZIP_1 IFT57 CheW Zn-C2H2_12
Other DBs
NCBI-GeneID: 100351096
NCBI-ProteinID: XP_008269560
Ensembl: ENSOCUG00000016209
LinkDB
Position
19
AA seq 442 aa
MEKSVEDPPTSAILLDHCHFSQVVFNSVEKFYVPGGDITCYYTFTQHFVPRRKDWIGIFR
VGWKTTREYYTFMWVTLPADLNKESAKQQEVQFKAYYLPKDDEYYQFCYVDQDGVVRGAS
IPFQFRPENEEDILVVTTQGQVEEIEQHNKELYRENQELKDSCVSLQTQNADMQAELQRK
QEELETLQSINKKLEQEAKEQKDRWETELLQLKEHNEKMSSENEKMGIRVDQLQVQLSTQ
EKEMEKLVQGDQDKTELLEQMKKENGQLFLSLTEQREQQKRLKHTVEEMKEKESQAAKKQ
EELTEENFDLSRRLSDNKIMLEALLREKENLERENELLKKDNSRLLSYMGLDVDSLPYPM
PTSNHGGAGQNPGLVYGNPYSGIQESSSSGLFSVKKCPTCKSDFADDMCEQQHVCLSCPI
CHKIFPAREKQIYEDHVLCHSL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggagaagtcagtggaagacccccccacgtctgccatcttgctggatcactgtcacttc
tctcaggtcgtctttaacagtgtggagaaattctacgtccccggaggggacatcacgtgc
tattacaccttcacccagcacttcgtcccccggcgtaaggactggattggcatcttcaga
gtggggtggaagacaacccgtgagtattacaccttcatgtgggtcactttgcccgctgac
ctaaacaaggaatcggccaaacagcaggaagtccagttcaaagcttattacctgcccaag
gatgatgagtattaccagttctgctacgtggaccaggatggtgtagtccggggagcaagt
attcccttccaattccgtccagaaaatgaggaagatatcctggttgttaccactcagggc
caggtggaagagattgagcagcacaataaggagctttaccgagaaaaccaggagctgaag
gacagctgtgtcagcctccagacgcagaacgcagacatgcaggccgagctacagaggaag
caggaagaactggaaaccctacagagcatcaataagaagttggaacaggaagccaaagag
cagaaggaccgttgggagacagagctgctgcaactgaaagagcacaatgagaagatgtcc
tcagagaatgagaagatgggcatcagagtggatcagcttcaggtccagctgtcaactcaa
gagaaagaaatggagaagcttgttcagggagatcaagacaagacagagctgttggaacag
atgaaaaaggaaaatggccaactcttcctcagtttaactgaacagagggagcagcagaag
aggctcaagcacactgtggaggagatgaaggagaaagaatcccaagcagcaaagaagcaa
gaggagttaacggaagagaactttgacctctcaagaagactgagtgataacaagattatg
ctcgaggctctgctgagagagaaggagaacctggaaagagaaaatgagctcttgaagaag
gataatagcagattgctgagctacatgggtctggatgttgactctttgccgtatccaatg
ccgacttcaaatcacggaggtgcaggacaaaacccaggactggtctatggaaacccatat
tctggtatccaagaaagttcctcctctggcctgttctccgtcaagaagtgccccacctgc
aaatcagactttgctgacgacatgtgtgagcagcagcacgtctgtctcagttgtccaatt
tgtcacaagatcttcccagcaagagagaagcagatctacgaagaccacgtgttatgccac
tcgctctaa

DBGET integrated database retrieval system