KEGG   Oryctolagus cuniculus (rabbit): 100351427
Entry
100351427         CDS       T03373                                 

Gene name
TOP2B
Definition
(RefSeq) topoisomerase (DNA) II beta
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100351427 (TOP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100351427 (TOP2B)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100351427 (TOP2B)
Enzymes [BR:ocu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     100351427 (TOP2B)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Topoisomerases
   100351427 (TOP2B)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    100351427 (TOP2B)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100351427 (TOP2B)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 100351427
NCBI-ProteinID: XP_008264291
Ensembl: ENSOCUG00000000717
LinkDB
Position
14
AA seq 1543 aa
MWVYDEEVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKISIDPESNIISIWN
NGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLAKFKMEKLDKDIVALMT
RRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVC
LTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKNHI
WVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQ
TQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDR
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKK
HIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDD
RKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVD
GFKPGQRKVLFTCLNRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNN
INLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQ
ELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEY
HTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILK
EFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQR
GYESDPVKAWKEAQEKAAEEEETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEE
LIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQEREDILAGMSGKAIKGKVG
KPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTTAVKVEFDEEFSGT
PIEGTGEEALTQSAPVNKGPKPKREKKEPGTRVRKTPTTSGKPSAKKVKKRNPWSDDESK
SESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDNNDLEELKVKASPI
INDGEDEFVPSDGLDKDEYTFSPGKSKTTPEKSSHDKKSQDFGSLFSFPSYSQKSEDDSA
KFDSNEEDSASVFSPSFGLKQTDKVPSKTAAAKKGKPTSDTTPKPKRTPKQKKVVETVNS
DSDSEFGIPKKSTAPKGKGRGAKKRKASGSENEGDYNPGRKPSKTTSKKPKKTSFDQDSD
VDIFPSDFTSEPPSLPRTGRARKEVKYFAESDEEEDVDFAMFN
NT seq 4632 nt   +upstreamnt  +downstreamnt
atgtgggtgtatgatgaagaagtaggaatgaattgcagagaggttacctttgtgccaggt
ttatataagatctttgatgaaattttggttaatgctgctgacaataaacagagggataag
aatatgacctgtattaaaatttcaattgacccagaatctaacattataagcatttggaat
aatgggaaaggcattccagtagtagaacacaaagtagagaaagtgtatgttcctgcttta
atttttggacagcttttaacatccagtaactatgatgatgatgagaaaaaagttacaggt
ggtcgcaatggttatggtgcaaaactttgtaatatttttagtacaaagtttacagtagaa
acagcttgcaaagaatacaaacacagttttaagcagacatggatgaataatatgatgaag
acctctgaagccaaaattaagcattttgatggtgaagattacacatgtataacattccaa
ccagatctggccaaatttaagatggaaaaacttgacaaggatattgtggctctcatgacc
agaagagcgtatgatttggctggttcatgtaaaggggtcaaagtcatgtttaatggaaag
aaattaccagtaaatggatttcgaagttatgtggatctttatgtgaaagacaaattagat
gaaactggagtggccctgaaagttattcatgaacttgcaaatgaaagatgggatgtttgc
ctcacactgagtgaaaaaggcttccagcaaatcagctttgtaaatagtattgcaacgaca
aaaggtggacggcacgtagactatgtagtagatcaagttgttggtaaactgattgaagtg
gttaagaaaaagaacaaagctggtgtatcagtgaaaccatttcaagtgaaaaaccacata
tgggtttttattaattgccttattgaaaatccaacttttgattctcaaactaaggaaaac
atgactttgcaacccaaaagttttggatccaaatgccaactgtcagaaaaattttttaaa
gcagcttctaattgtggcattgtagaaagtatcctgaactgggtgaaatttaaagctcag
actcagctgaacaagaagtgttcatcagtaaaatatagtaaaatcaaaggtattcccaaa
ctggatgatgctaatgatgctggaggcaaacattccctggaatgtacactgatattaaca
gagggagactctgccaaatcactggccgtgtctggattaggtgtgattgggcgagacaga
tacggagtttttccactcaggggtaaaattcttaatgtacgggaagcttctcataaacag
atcatggaaaatgcagaaataaataatattattaaaatagttggtctacagtacaaaaaa
agttatgatgatgcagaatctctgaaaacattacgttatggaaagattatgattatgact
gatcaggatcaagatggttctcatatcaaaggcctgcttattaatttcattcatcacaat
tggccatcacttttgaagcatggttttcttgaagagttcattactcctattgtaaaggca
agcaaaaataagcaggaactttccttctacagtattcctgaatttgatgagtggaaaaaa
catatagaaaaccagaaagcctggaaaataaaatactacaaaggattgggtaccagtaca
gctaaagaagcaaaagaatattttgctgatatggaaaggcatcgcatcttgtttagatat
gctggccctgaagatgatgctgccattaccttggcattcagtaagaagaagattgatgac
agaaaagaatggttaacaaattttatggaagatcggaggcagcgtaggttacatggctta
ccagagcaatttttatatggtacagcaacaaaacatttgacttacaatgatttcatcaac
aaggaattgattctgttctcaaactcagacaatgagagatctataccatctcttgttgat
ggtttcaaacctggccaacgaaaagttttatttacctgtttgaatcggaatgataaacgt
gaagtaaaagttgcccagttggctggatctgttgctgagatgtctgcctatcatcatgga
gaacaagcgttgatgatgacaattgtgaacttggctcagaactttgtgggaagtaacaac
attaacttgcttcagcctattggtcagtttgggactcgacttcatggtggcaaagatgct
gcaagccctcgttatattttcacaatgttaagctctttagcaagattactttttcctgct
gtggatgacaacctgcttaagtttctttatgatgataatcaacgtgtagagcctgagtgg
tatattcccataattcccatggttttaataaatggtgctgaaggcattggtactggatgg
gcttgtaaactaccaaattatgatgccagggaaatcgtgaacaatgtcaggcgaatgcta
gatggtttggatcctcatcccatgcttccaaactataagaactttaaaggcacaatccaa
gaacttggtcaaaaccagtatgcagtcagtggtgaaatatttgtggttgatagaaacaca
gtagaaattacagagcttccagtcagaacttggacacaggtatacaaagaacaagttttg
gaacctatgctaaatgggaccgacaaaacaccagcattaatttctgattataaagaatat
catactgatacaactgtgaaatttgtggtgaaaatgacagaggagaaactagcacaagca
gaagctgctggattacataaagtttttaagcttcaaactactctgacttgtaattccatg
gtactctttgatcatatgggatgtctgaagaagtatgaaactgtgcaagacattctgaaa
gaattctttgatttacggttaagttattatggtttacgaaaggagtggcttgtaggaatg
ttgggagcagaatctacaaagcttaacaatcaagcccgtttcattttagagaagatacaa
gggaaaattactatagagaataggtcaaagaaagatttgattcaaatgttagtccagaga
ggttatgaatctgacccagtgaaagcctggaaagaagcacaagaaaaggcagcagaagag
gaagaaacacaaaaccagcatgatgatagttcctccgattcaggaactccttcaggcccc
gattttaattatattttaaatatgtctctgtggtctcttactaaagaaaaagttgaagaa
ctgattaaacagagagatacaaaaggacgagaggtcaatgatcttaaaagaaaatctcct
tcagacctttggaaagaagatttagcagcatttgttgaagaactggataaagtggaagct
caagaacgagaagatatcctggctggaatgtctggaaaagcaataaaaggtaaagttggc
aaacctaaggtgaagaagcttcaattggaagagacaatgccctcaccttatggaaggaga
ataattccagaaattactgccatgaaggcagatgccagcaaaaagttactgaagaagaag
aagggtgatcttgataccacagcagtaaaagtagagtttgatgaagaattcagtggaaca
ccaatagaaggtacaggagaagaggcactgacacaatcagcacctgtaaacaaaggcccc
aagcccaaaagggagaaaaaagagcctggtaccagggtgagaaaaacacctacaacatct
ggtaaacccagtgcaaagaaagtgaagaaacggaatccttggtcagatgatgaatccaag
tcagagagtgatttggaagaaacagaacctgtggttattccaagagattctttgcttagg
agagcagctgctgaaagacctaaatacacatttgatttctcagaagaagaggatgatgat
gctgatgatgatgatgacaataatgacttagaggagctgaaagttaaagcatctcccata
ataaatgatggggaagatgaatttgttccttcagatggcctggataaagatgaatataca
ttttcaccaggcaaatcaaaaactactccagaaaaatcttcacatgacaaaaaaagtcag
gatttcgggagtctcttctcatttccttcatactctcaaaagtcagaagatgattcagct
aaatttgacagtaatgaagaagattctgcttctgttttttccccgtcgtttggtttgaaa
caaacagataaagttccaagtaaaacagcagctgccaaaaagggaaaaccaacttcagat
acaacccctaagcccaagagaacacccaaacagaagaaagtagtagagactgtaaactct
gactcagattcagaatttggcattccaaagaagagtacagcaccaaaaggtaaaggccga
ggggcaaagaaaaggaaagcttctggttccgaaaatgaaggtgattataaccctggcagg
aaaccatccaaaaccacaagcaagaaaccgaagaaaacatcttttgatcaggattcagat
gtggacatcttcccctcagacttcacttctgaaccaccttctctgccacgaactggccga
gctagaaaagaagtaaaatattttgcagaatctgatgaagaagaagatgttgattttgca
atgtttaattaa

KEGG   Oryctolagus cuniculus (rabbit): 100357676
Entry
100357676         CDS       T03373                                 

Gene name
TOP2A
Definition
(RefSeq) topoisomerase (DNA) II alpha
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100357676 (TOP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100357676 (TOP2A)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100357676 (TOP2A)
Enzymes [BR:ocu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     100357676 (TOP2A)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Topoisomerases
   100357676 (TOP2A)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    100357676 (TOP2A)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100357676 (TOP2A)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim Filaggrin
Other DBs
NCBI-GeneID: 100357676
NCBI-ProteinID: XP_017204684
Ensembl: ENSOCUG00000002814
LinkDB
Position
19
AA seq 1533 aa
MEVSPLQPVNENMQMNKIKKNEDAKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQH
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKSFSGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKVDETGNPLKVIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVAKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGSRNSAECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSRNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVINGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILK
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDTEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK
KDELCRQRNEKEQELETLKRKGPSDLWKEDLAAFIEELEAVEAKEKQDEQVGLPGKGGKA
KGKKTQMAEVLPSPRGKRVIPRVTTEMKAEAEKKIKRKIKSENTEGSPKEDGTELEDLKQ
RLEKKQKREPGTKTKKQTTLPFKPIKKAKKRNPWSDSESDMSSNESNFDVPPREIEPRRA
ATKTKFTVDLDSDDDFSDFDEKTQDDDFVPSYASPPQTKTSPKPTKKELKPQKSAMSVAD
LEVDDAKDEAPLSSSPPAADFPGETETVNPVTKKNVTVKKTAAKSQSSTSTTGAKKRAAP
KGTKKNPALNSDVSQKPEPAKTKTQRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGENDDF
LLDLDSSVAPRAKSSRAKKPIKYLEESDEDDLF
NT seq 4602 nt   +upstreamnt  +downstreamnt
atggaggtgtcaccactgcagcctgtcaatgaaaatatgcaaatgaacaaaataaagaaa
aatgaagatgcgaagaagagactgtctattgaaagaatctatcaaaagaaaacgcagttg
gaacatattttgctccgccccgatacctacattggctctgtagaattagtgacccagcac
atgtgggtttacgatgaagatgttggtattaactacagggaagtcacttttgttcctggt
ttgtacaaaatctttgacgagattctagttaatgctgcggacaataaacaaagggacccc
aaaatgtcttgcattagagtcaccattgatccagaaaataatttaattagcatatggaat
aatggaaaaggtattcctgttgttgaacacaaagttgagaagatgtatgtcccagctctc
atatttggacagctcctaacgtccagtaactatgatgatgatgaaaagaaagtaacaggt
ggtcgaaatggctatggagccaaattgtgtaacatattcagtaccaaatttactgtggaa
acagccagtagagaatataaaaaaatgttcaaacagacttggatggataacatggggaga
gctggtgagatggagctcaagtcctttagtggagaagattatacatgtatcacctttcag
cctgatttgtctaagtttaaaatgcaaagcctggacaaagatattgttgcactgatggtt
agaagagcatatgatattgctgggtccactaaagatgtcaaagtcttccttaatggaaat
aagctgccagtgaaaggattccgtagttatgtggatatgtatttgaaggataaggtagat
gaaactggtaacccactgaaagtaatacatgagcaagtaaaccacagatgggaagtatgt
ttaacaatgagtgaaaaaggctttcagcaaattagctttgtcaacagcattgccacctcc
aagggtggcagacatgttgattatgtagctgatcagattgtggctaaacttgttgatgtt
gtaaagaagaagaacaagggtggtgttgcagtaaaagcacatcaggtgaaaaatcacatg
tggatttttgtgaacgccttaattgaaaacccaacctttgactctcagacaaaagaaaac
atgactttacaagccaagagctttggatcaacatgccagttgagtgaaaaattcatcaaa
gctgcaattggctgtggtattgtagaaagcatactgaactgggtgaagtttaaggcccaa
gtccagttaaacaagaagtgttcagctgtaaagcataacagaatcaagggaattcccaaa
cttgatgatgccaatgatgcagggagccgaaactctgctgaatgtacacttatcctgact
gagggagactcagccaagactttagctgtttcagggcttggtgtggttggaagagacaaa
tacggggttttccctcttagaggaaaaatactcaatgttcgagaagcttctcataaacag
attatggaaaatgctgaaattaacaatattatcaagattgtgggtcttcagtacaagaaa
aactatgaagatgaagattcattaaagactcttcgttatgggaagataatgattatgaca
gatcaggaccaagatggttcccatatcaaaggcttgctgattaattttatccatcacaac
tggccttcgcttctgcgacatcgttttctggaagaatttatcactccaattgtaaaggtt
tcgagaaacaagcaagaaatggcattctatagccttcccgaatttgaagaatggaagagt
tctactccaaatcataaaaagtggaaagtcaagtattacaaaggtttgggcactagcaca
tcaaaggaagctaaagaatactttgcagatatgaagagacatcgtatccaattcaaatat
tctggtcctgaagatgatgctgcaatcagcctggcctttagcaaaaagcaaatagatgat
cgaaaagaatggttaactcatttcatggaggatagaagacaacgaaagttacttggcctt
cctgaggattacttatatgggcaaaccaccacatatctgacatacaatgacttcataaac
aaagaacttatcctcttctcaaattctgataatgagagatctatcccgtcaatggtagat
ggtttgaaaccagggcagagaaaggttttgtttacttgtttcaaacggaatgacaagcga
gaagtgaaggttgcccagttagctgggtcagtggcagaaatgtcttcttaccatcatggt
gagatgtcgctgatgatgaccattatcaatttggctcagaattttgtgggtagcaataac
ctgaacctcttacagcccattggtcagtttggtaccaggctgcatggtggcaaggattct
gctagtcctcgatacatcttcaccatgcttagccctttggctcggctattatttccacca
aaagatgaccacacgttaagattcttatatgatgacaaccaacgagttgagcctgaatgg
tacattcctattatacccatggtgctgataaatggtgctgaaggaattggtactgggtgg
tcctgcaaaatccccaactttgatgttcgtgaaattgtgaataacatcagacgtttgatg
gatggagaagaaccattgccaatgcttccaagttacaagaacttcaagggtactattgaa
gagctggctccaaatcagtatgttattaatggtgaagtagctattcttaattccacaacc
attgaaatctcggagcttcccgtcagaacgtggacccagacatataaagaacaagttcta
gaacccatgttgaatggcaccgagaagacaccccctctcataacagactacagggaatac
cacacagataccactgtgaagtttgttgtgaagatgactgaagaaaaactggcagaggca
gaaagagttgggttacacaaagtcttcaaactccaaaccagtctcacctgcaactctatg
gtgctttttgaccatgtaggctgtttaaagaaatatgacacagtcttggatattctaaaa
gacttctttgaactccggcttaaatattatggcttaagaaaagagtggcttctaggaatg
cttggtgctgaatctgctaaactgaacaatcaggctcgttttatcttagagaaaatagat
ggcaaaataatcattgaaaataagcctaagaaagaattaattaaagttctgattcagaga
ggatatgattcggatcctgtgaaggcctggaaagaagcccagcaaaaggtcccagatgaa
gaagaaaatgaagagagtgacactgaaaaggaaactgaaaaaagtgactctgtaacagat
tctgggccaaccttcaactacctgcttgatatgcccctttggtatctaaccaaggaaaag
aaagatgagctgtgcagacaaagaaacgaaaaagagcaagagctggaaacattaaagaga
aagggcccatcggatttgtggaaagaagacctggctgcttttattgaagaactggaggct
gttgaagccaaggaaaaacaagatgagcaagtaggacttcctgggaaaggggggaaagca
aaagggaaaaaaacacaaatggctgaagttttgccttctccacggggaaaaagagtcatt
cctcgagtgaccacggagatgaaggcagaagcagaaaagaaaatcaaaaggaaaattaag
agtgaaaatactgaaggaagccctaaggaagatggtacagaactagaagacttaaaacaa
agattagagaagaaacagaaaagagaaccaggtaccaagacaaagaagcaaactacactg
ccatttaaaccaataaaaaaagcaaagaagagaaacccctggtctgattcagaatcagat
atgagcagtaacgaaagcaattttgatgtccctccaagagaaatagagccacggagagca
gcaacaaaaaccaaattcacagtggatttggattcagatgatgatttctcagattttgat
gaaaaaactcaagacgacgattttgtcccatcatatgctagtccacctcagaccaaaact
tccccaaaacccactaagaaagaactgaagccacagaaaagtgccatgtcagtagcagac
cttgaagttgatgatgctaaggatgaggcaccactttcttcaagccctcctgctgctgat
ttcccaggtgaaactgaaactgtaaacccagttactaaaaagaatgtgaccgtgaagaag
acagcagcgaaaagtcagtcttccacctccactactggtgccaaaaaaagggctgcacca
aaaggaaccaaaaagaatccagccttgaattctgatgtctctcaaaagcctgaacctgcc
aaaacgaagactcagcgcaaaaggaagccgtcaacttctgacgattctgattctaatttt
gagaaaattgtttccaaagcagtcacaagcaagaaatccaaaggggagaatgatgacttc
cttctcgacttagactcaagtgtggctcctcgggcaaaatccagcagggcaaagaaacct
ataaagtaccttgaagagtcagatgaagatgatctgttttaa

DBGET integrated database retrieval system