KEGG   Oryctolagus cuniculus (rabbit): 100351460
Entry
100351460         CDS       T03373                                 

Gene name
GLE1
Definition
(RefSeq) GLE1, RNA export mediator
  KO
K18723  nucleoporin GLE1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100351460 (GLE1)
   03015 mRNA surveillance pathway
    100351460 (GLE1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100351460 (GLE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100351460 (GLE1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100351460 (GLE1)
SSDB
Motif
Pfam: GLE1 DUF4208
Other DBs
NCBI-GeneID: 100351460
NCBI-ProteinID: XP_002723014
Ensembl: ENSOCUG00000012314
UniProt: G1T324
LinkDB
Position
Un
AA seq 698 aa
MPSEGRCWETLQALRSSDKGRLCYDRDWLLRGEDVLEECMSLPKLSPYSGWVVDHVLPHT
QENPPGSETSPTSGPASALDPPPSVSRSSVRSSAFSSASPTTPEGVQDKPESQHPECIAL
QSSRGIQVEGCIRMYEQVHRMKGAEGLRQWQEEQERRVRALSEMACEQLKRFDERKELKQ
HKEFQDLREVIEKSAREALGHQEKLKAEHRHRAKILNLKLREAEQQRLRQVEQERLWREE
GQVRLRSLYSLQEEVLQLSQQLDASDQHRDLPNVDLAAFRTRGNQLCSLVSGIIRASSES
GYPTAENQAEAEQALQEMRDLLVNLGQEITRACEDKKQQEEKEAQARLQESQMHQGQEAH
KESAASSQGPRDKQHGALQVKVQDSTIQWYQQLQEVSSQCVRAFEGLTSSKDIQAKKIKM
DLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQSGGRSVSVTLNPQGLDFVQYKL
AEKFVKQGEEEVASHHEAAFPIAVVASGIWELHPRVGDLILAHLHRKCPYSVPFYPAFKE
GMALEDYQRMLGYQVKDSKVEQQDTFLKRMSGMIRLYAAIIQLRWPYGNRQETHPHGLNH
GWRWLAQILNMEPLSDVTATLLFDFLEVCGNALMKQYQLQFWKMILLIKEEYFPRIEAIT
SSGQMGSFIRLQQFLEKCLQRREIPVPKGFLTSSFWRS
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgccgtccgagggccgctgctgggagaccctacaggcgctgcgcagctccgacaaaggt
cgcctgtgctacgaccgcgactggcttctgcggggcgaggatgtgttggaagaatgtatg
tctcttcccaagctgtctccttactccggatgggtggtcgatcacgttctaccccacacg
caagagaacccacctggctctgagacttcacccacctctggacccgcctcagccctagac
ccacccccgtccgtttccaggtcttctgtcagaagctctgccttctcctcagcctccccc
acgacaccagagggggtccaggacaaacctgagtcccagcatccagaatgtatagcgctt
cagtcctcccgggggatccaagtcgaaggatgcatccgaatgtacgaacaggtgcacaga
atgaagggagcggagggcctgcggcagtggcaggaggagcaagagaggagggtgcgcgcc
ctctcggagatggcctgtgagcagctgaagcgctttgacgagcggaaggagctgaagcag
cacaaggagttccaggacttacgggaagtgatcgagaagagcgccagagaagccctgggg
caccaggagaagctaaaagctgagcatcggcacagagccaagatcctgaacctgaagctg
cgggaggcagagcagcagcggctgaggcaggtggagcaggagcggctgtggagggaggag
ggccaggtccgcctgcgcagcctctactccctgcaggaggaggtgctgcagctcagccag
cagctggacgcctcggaccagcacagggacctgcccaacgtcgacctggccgccttccgg
acccgaggcaaccagctgtgcagcctcgtctctggcatcattcgggcctcctcggagagc
ggctaccctacagcagagaaccaggctgaggctgagcaagccctgcaggaaatgcgtgac
ctcctggtgaacttggggcaggagatcaccagagcctgcgaagacaagaagcagcaggag
gaaaaggaggcccaggccagactgcaggagtcacagatgcaccagggccaggaggcccac
aaggagtcggcggcttccagccagggcccaagagacaaacagcatggagccctccaggtg
aaggtgcaagacagtacaatacagtggtaccagcagctgcaggaggtgtcctctcagtgc
gtgagggcctttgagggcctgaccagcagcaaggacatccaggccaagaagatcaagatg
gacctccagaaggctgccaccatccctgtgagccagatctccaccattgcaggctcgaag
ctgaaggagatctttgacaagattcacagtctgctctctggaaaacccgttcagtctggt
gggcgctctgtatccgtcacactcaacccacaggggctggattttgtccagtacaaactg
gcagagaaatttgtgaaacaaggcgaggaggaagtggcctctcaccacgaagccgccttc
cccatcgcggtggtggcctcagggatctgggagctccaccccagggtgggggacctcatc
cttgctcatctacacaggaagtgcccttactccgtccccttctacccggctttcaaggag
ggaatggctttggaggactatcagaggatgcttggctaccaggtgaaggattccaaggtg
gaacagcaggacaccttcctcaaacgcatgtctgggatgatccgtctctatgccgccatc
attcagctccggtggccgtacggaaaccgacaggagacgcaccctcatggtctaaatcat
ggctggcgctggttggcacagatcttgaacatggagcccctatccgatgtcacagccact
cttctctttgacttcttggaggtgtgtgggaatgccctcatgaagcagtaccagctccag
ttctggaagatgattcttctcatcaaggaggagtactttcccagaattgaagccatcaca
agttcaggccagatgggctccttcatacgcctccagcagttccttgagaaatgtttgcaa
cgcagggagattcctgttcccaagggctttctgacttcctccttctggcgctcctga

DBGET integrated database retrieval system