KEGG   Oryctolagus cuniculus (rabbit): 100351553Help
Entry
100351553         CDS       T03373                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00512  Mucin type O-glycan biosynthesis
ocu01100  Metabolic pathways
Module
ocu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100351553 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ocu01003]
    100351553 (GALNT9)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100351553 (GALNT9)
Glycosyltransferases [BR:ocu01003]
 O-Glycan biosynthesis
  Mucin-type
   100351553 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100351553
NCBI-ProteinID: XP_008248629
Ensembl: ENSOCUG00000014235
LinkDB All DBs
Position
Un
AA seq 532 aa AA seqDB search
LCFPISPPGLAKPIGLVEGPGGLGQGGVAATLRTDSQETDVKYEEYGYNAQLSDRISLDR
TIPDYRPKKCRQMTYSEELPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVILVDD
NSDNAELKFNLDQYVHRRYPGLVKIVRNSRREGLIRARLQGWKVATAPVVGFFDAHVEFN
TGWAEPALSRIREDRRRVVLPAIDNIKFNTFEVQQYANAAHGYNWGLWCMYIIPPQDWLD
RGDEAAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLP
CSRVAHIERSRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPMTNPGVDFGDVS
ERLALRRRLKCRSFQWYLENVYPEMRVYSDTLAYGEVRNSKASGYCLDQGSEDDDQAILY
PCHGMSSQLVRYSTDGLLQLGPLGSTAFLPDSKCLVDDGGGRSPALRKCEDVARPTQRLW
DFTQSSPIVSRDTGRCLEVEMSKEANFGLRLVVQRCSGQKWVIRNWVRHRRH
NT seq 1601 nt NT seq  +upstreamnt  +downstreamnt
ctctctgttttcctatctcccctccaggccttgccaaacccatcggtctggtggaggggc
caggcggcctgggccaggggggcgtggccgccacgctccgcacggacagccaggagacag
acgtcaagtacgaggagtacgggtacaatgcccagctcagcgaccgcatctccctggaca
ggaccatccccgactacaggcccaaaaagtgcaggcagatgacctactccgaagagctgc
cccaggtctccgtggtcttcatatttgtcaatgaggccctctcggtcatcctgcgctccg
tccacagcgtggtcaaccacacgccctcccagctcctgaaggaggtcatcctggtggacg
acaacagtgacaatgcggagctcaagttcaacctggaccagtacgtccacaggaggtacc
caggcctggtgaagatcgtccgcaacagccggcgggaaggcctgattcgggcgcggctgc
agggctggaaggtggccacggcccccgtcgtcggcttcttcgacgcccacgtcgagttca
acacgggctgggccgagcctgccctctcgcggatccgggaagaccggcgtcgcgtggtcc
tgcccgccatcgacaacatcaagttcaacacgttcgaggtgcagcagtacgccaacgcgg
cccacggctacaactggggcctctggtgcatgtacatcatcccgccccaggactggctgg
accgtggcgacgaggcagcgcccatcaggacccccgccatgatcggctgctccttcgtgg
tggaccgggagtacttcggggacatcggcctgctggaccctggcatggaagtgtacggcg
gggagaacattgagttgggtatgcgggtgtggcagtgcggcggcagcatggaggtgctgc
cctgctcccgcgtggcccacatcgagcgcagcaggaagccctacaacaatgacattgact
actatgccaagcgcaacgccttgcgggcagctgaggtgtggatggacgacttcaagtcgc
acgtgtacatggcctggaacatccccatgacgaacccaggggtggacttcggggacgtgt
ccgagaggctggccctgcgccgcaggctgaagtgccgcagcttccagtggtacctggaga
acgtgtaccccgagatgagggtctacagcgacacgctggcctacggagaggtgcgaaaca
gcaaagccagcggctactgcctggaccagggctcggaggacgacgaccaggccatcctgt
acccctgccacgggatgtcctcccagctagtgcggtacagcacagacggcctcctgcagc
tcggacccctgggctccaccgccttcctgcccgactccaagtgtctggtggacgacggcg
ggggccggagccctgccctgaggaagtgcgaggatgtggcccggcccacccagcggctgt
gggacttcacccagagcagccccatcgtgagccgagacaccggccggtgcctggaggtgg
aaatgtccaaagaagccaacttcgggctgcggctggtggtgcagaggtgctcagggcaga
agtgggtgatccgaaactgggtcaggcacaggcggcactga

DBGET integrated database retrieval system