KEGG   Oryctolagus cuniculus (rabbit): 100351623
Entry
100351623         CDS       T03373                                 

Gene name
NLRP3
Definition
(RefSeq) NLR family pyrin domain containing 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100351623 (NLRP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100351623 (NLRP3)
   04625 C-type lectin receptor signaling pathway
    100351623 (NLRP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100351623 (NLRP3)
   05135 Yersinia infection
    100351623 (NLRP3)
   05133 Pertussis
    100351623 (NLRP3)
  09172 Infectious disease: viral
   05164 Influenza A
    100351623 (NLRP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351623 (NLRP3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100351623 (NLRP3)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100351623 (NLRP3)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100351623 (NLRP3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 LRR_6 PYRIN NOD2_WH FISNA LRR_4 NB-ARC AAA_25 AAA_16
Other DBs
NCBI-GeneID: 100351623
NCBI-ProteinID: XP_017194665
Ensembl: ENSOCUG00000005455
UniProt: G1SNY9
LinkDB
Position
Un
AA seq 1046 aa
MAGTRCKLAQYLEDLEELDLKKFKMHLEDYPPDQGCIPLPRGQAARADPVDLATLMIDFN
GEEKAWAMALWIFTAINRRDLYERAKRDEPVWEPAHVSNATVICHEEIIEEERMGILGHL
SRISICTKRKDYCKKYRKHVRSRFQCIEDRNARLGESVNLNKRYTRLRLAKEHLSRQERE
QELVAIGRTHVWDSPASPVRVELLFDADEECLEPVRTVVLQGAAGIGKTILARKIMLDWA
SGQLFQDRFDYLFYIHCREMSLGMHRSLVDLIAGCCSDPSPPVSKMLHRPSRVLFLMDGF
DELQGAFDESSGALCSDWRVAVRGDVLLGSLIRKKLLPEASLLITTRPVALEKLQHLLDR
PRHVEVLGFSEARRKEYFFKYFLEEAQAREAFSLLQENEVLLSMCCIPLVCWIVCTGLKQ
QMQGGKHRAKTTTSKTTTAVYTFFLSSLLQSRGGSQEQRLSGHLRGLCSLAADGIWNQKI
LFEERDLRRHGLQEAEVSAFLRMSLFQKEVDCEAFYSFVHLTFQEFFAAMYYVLEEEEEE
KEEEEGAGTGRSPPARGLDLPHRDVRVLLENYGKFEKGYLIFVVRFLFGLVNQERASYLE
KKLSCKISQQVRPELLRWIETKANAKKLQIQPSQLELFYCLYEMQEEAFVREAMGHFPRI
EINLSTRMDHVVSSFCIGNCHSVESLSLGFLHNSPKEEEEEEEEEEVESPLFDVGCPNRQ
GPHAACSWRLVNSCLTSSFCRGLFSVLSTNPSLTELDLSDNSLGDPGMRVLCEALQHPGC
NIRRLWLGRCGLSHQCCFDISLVLSGSQKLVELDLSDNALGDFGVRLLCVGLRHLSCQLQ
KLWLVSCCLTSMCCQDLASVLSTNHCLTRLYLGENTLGDYGVGLLCEKVKHPQCNLQKLG
LVNSGLTSACCAALSAALSTSRSLTHLYLRGNALGDAGVKLLCEGLLHPSCRLQMLELDS
CSLTSHCCWNLCTILTCSRSLRKLSLGNNDLGDLGVMMLCEVLRQPDCPLQRLQLCEMYF
NPETIHALETLREEKPALTVVFEPSW
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggccggcactcgctgcaagttggcccagtacctggaggaccttgaggagctggacctc
aagaagttcaagatgcacttggaggactacccccccgaccagggctgcatccccctcccc
aggggccaggcagccagggctgaccctgtggatcttgccaccctcatgattgacttcaat
ggggaggagaaggcctgggccatggccctgtggattttcacggccatcaacaggagagac
ctttatgagagagctaagagggatgagccagtgtgggaacctgcacatgtttctaacgcc
actgtgatatgccatgaagagatcatcgaagaggagaggatgggtatccttgggcacctc
tcccggatctccatttgtacaaagagaaaagattactgtaagaagtaccgcaagcatgtg
cgcagcaggttccagtgcattgaagacaggaatgcccggctgggcgagagcgtgaacctc
aacaagcgctacacacggcttcgcctggccaaggagcacctgagccggcaggagcgggag
caggagttggtggccatcggcaggacccacgtgtgggacagccccgcaagcccagtccgg
gtggagctgctcttcgacgccgatgaggagtgcctcgagcctgtgcgcacggtggtgctc
cagggggcagcgggcatcgggaagaccatcctggccaggaagatcatgctggactgggct
tcagggcagctcttccaggacaggttcgattacctgttctacatccactgccgggagatg
agcctggggatgcacaggagcctggtggacctgattgccggctgctgctccgaccccagc
ccccctgtgagcaagatgttgcacaggccgtcccgtgtcctcttcctcatggacggcttc
gacgagctgcaaggtgctttcgatgagagcagcggggcgctgtgcagtgactggagggtg
gccgtgcggggggatgtcctcctgggcagcctcatcaggaagaagctgctccccgaggcc
tcactgctcatcaccaccaggcccgtggctctggagaagctgcagcacctcctggaccgc
ccccgccacgtggaggtgctgggcttctccgaggcccggcggaaggagtatttcttcaag
tacttcctggaggaggcgcaggccagggaggccttcagcctcctccaggagaatgaggtc
ctgctcagcatgtgctgcatcccgctggtgtgctggattgtgtgcacggggctgaagcag
cagatgcagggcggcaagcacagggccaagaccaccacctccaagaccaccacagctgtg
tacacattcttcctgtccagcttgctgcagtcccgcggaggcagccaggagcaacgcctc
tctggccacctccggggtctctgctccttggctgctgatggcatctggaaccagaaaatc
ctgtttgaggagcgtgacctgaggaggcacggcctgcaggaggcagaagtgtctgccttc
ctgaggatgagcctgttccagaaggaggtggactgcgaggccttctacagcttcgtccac
ttgaccttccaggagttctttgctgccatgtactatgtgctggaggaggaggaggaggaa
aaggaggaggaggagggggcaggcacagggaggagcccgccggcaaggggcttggacctc
ccacaccgagatgtgagggtccttctcgaaaactatggcaaattcgaaaaggggtatctg
attttcgttgtgcgtttcctcttcggccttgtgaatcaggagagggcctcctacctggag
aagaagctgagctgcaagatctcccagcaagttcggccagagctgctgcggtggatcgag
acaaaagccaacgccaagaagctgcagatacagccaagccagctggagctgttctactgc
ctgtatgagatgcaggaggaggcctttgtgcgggaggccatgggccacttccccagaatc
gagatcaacctctccacccgcatggaccacgtggtgtcctctttctgcattggaaactgt
cacagcgtagaatcactttcactggggtttctgcataattcacccaaggaggaagaggag
gaggaggaggaagaggaggtggaaagtccactctttgatgtgggctgccccaaccgccag
ggccctcatgccgcctgctcatggagattggtgaactcctgtctcacgtccagcttttgc
cggggcctcttctcagttctaagtaccaatccaagcctgacagaactggacctgagtgac
aacagcctgggagaccctggaatgagggtcctgtgtgaggcgctccagcatcccggctgc
aacattcgcagactctggctgggccgctgtggcctctcccaccagtgctgcttcgacatc
tcactggtcctgagtggcagccagaagctggtggagctggacctgagtgacaacgccctg
ggagactttggggtcaggctgctgtgtgtggggctgaggcacctgtcctgccagctgcag
aagctctggttggtcagctgctgcctcacgtccatgtgctgccaggatctcgcctcagtc
ctcagcaccaaccactgtctgaccaggctgtatctgggggaaaacaccttgggagactac
ggagttggacttctgtgtgaaaaagtcaagcatccacagtgtaacctgcagaaactgggg
ctggtgaattctggccttacctcagcctgctgtgcggctctgtctgcagcactcagcacc
agcaggagcctcacacacctctacctgcggggcaacgcccttggagacgcaggggtgaag
ctgctctgtgaaggactgctgcaccccagctgcaggctgcagatgttggagttagacagc
tgcagcctcacctcgcactgctgctggaatctctgcacgatcctgacctgcagccgcagc
ctgcggaagctgagcctgggcaacaacgacctgggcgacctgggcgtcatgatgctctgc
gaggtcctcagacagccggactgccccctgcagaggctgcagttgtgtgagatgtacttc
aaccctgagacgatccacgccttggaaacactgcgggaagagaaacctgcattgactgtc
gttttcgagccttcgtggtag

DBGET integrated database retrieval system