KEGG   Oryctolagus cuniculus (rabbit): 100351640
Entry
100351640         CDS       T03373                                 

Gene name
TSC2
Definition
(RefSeq) tuberous sclerosis 2
  KO
K07207  tuberous sclerosis 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04072  Phospholipase D signaling pathway
ocu04115  p53 signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04218  Cellular senescence
ocu04714  Thermogenesis
ocu04910  Insulin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100351640 (TSC2)
   04151 PI3K-Akt signaling pathway
    100351640 (TSC2)
   04152 AMPK signaling pathway
    100351640 (TSC2)
   04150 mTOR signaling pathway
    100351640 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100351640 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100351640 (TSC2)
   04218 Cellular senescence
    100351640 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100351640 (TSC2)
   04919 Thyroid hormone signaling pathway
    100351640 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    100351640 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100351640 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100351640 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100351640 (TSC2)
   05163 Human cytomegalovirus infection
    100351640 (TSC2)
   05165 Human papillomavirus infection
    100351640 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100351640 (TSC2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100351640 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Cnd1 Telomere_reg-2
Other DBs
NCBI-GeneID: 100351640
NCBI-ProteinID: XP_008251882
LinkDB
Position
Un
AA seq 1809 aa
MAKPTSKDSGLKEKFKILLGLGTPRPSPRSAEGRQTEFVITAEILRELSVDCGLNNRIRV
IGQICEVAKTKKFEEHAVEALWKAVADLLQPERPPEARHAVLALLRAIVQGQGEHLGALR
ALFFRVIKDYPSNEDLHERLEVFKALTDNGRHIAYLEEELAEFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCIRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTVNVKELCEPCWKLMRNLLGTHLGHSAVYNMCRLMEDRTYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEVVLSVSRLIKKYRKELQAVTWDL
LLDIVERLLQQLQSLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQRPE
SSLLNLVSYRAQSIHPAKDGWIQNLQLLMERFFRNETRSAVRIKVLDVLSFVLLINRQFY
EEELINTVVISQLSHIPEDNDHQVRKLATQLLVDLAEGCHTHHFNSLLDVIEKVTARSLS
PPPELDERGAAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYETLVSHLQLHYKH
NYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDYIEPERSSEKKAS
GPLSPPTGPPGPAHAGPAVRLGYLPYSLLFGLLLQCLKQETDWKVLKLVLSKLPESLRYK
VLVFTSPCSLDQLSSALCSMLSGPKTLERLRGTPEGFCRTDLHLAVVPVLTALISYHNYL
DKSKQREMVYCLEQGLIHRCAGQCVVALAVCSVEMPDIIIKALPVLVVKLTHISATASMA
VPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLMSFDDTPEKDSFRARSTSLNERPKSLRIARAPRPGLAHS
PPVDECKGSPAAEAFRCRSVSVSEHGVRRIQTSLTSASLGSADENSMAQADDNLKNLHLE
LTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLL
GLDSGELQGGGPELSSDPGVHLRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVG
ALDPPTSHFPGSPSAPGTQAAPAAKPDRASAGTQGPAQERTNLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAST
ARPPPLPRSNTVASLSSLCPSSCQGKLHRSISWADSAVVLEEGGAGEASGLAEPPELEDQ
GHCGRAGAYSRSSSASSQEEKLHAEDLAAGGVPIERAVSSAGGRPSVDLSFQPSQPLSKS
SSSPELQTLQDILGDPGDKVDVGRLSPEAKARSQSGLLDGDGAAWAAADEEPQGLGPAQP
EGALASGSPRSPGGLRPRGYTISDSAPSRRGRRADRVERDTFKSRAAATNAEKVAGINPS
FVFLQLYHSPFFGDDSNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELA
ILSNEHGSYRYAEFLTGLGKLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFH
IATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIRGQFNFVHVIITPLDYEC
NLVSLQCRKDMEGLVDTSMAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKW
IARLRHIKRLRQRIREAAQYSNSSLPVLHTHTPAHAKAPAQAPAEPAPPYETGQRKRLLS
SVDDFTEFV
NT seq 5430 nt   +upstreamnt  +downstreamnt
atggccaagccgacgagcaaggactccggcctcaaggagaagttcaagatactgctgggg
ctggggaccccgaggccgagccccaggtccgcggagggcaggcagaccgagttcgtcatc
accgccgagatcctgagggagctgagtgtcgactgtggcctcaacaatcgcatccgggtc
atagggcagatctgcgaagtcgccaagacgaagaagttcgaagagcacgccgtggaagcc
ctgtggaaggccgtggctgacctgctgcagccagagcggcctccggaagcccggcacgcg
gtgctggccctgctgagagccatcgtgcaggggcagggggagcacttgggggccctcaga
gccctgttcttcagggtcatcaaggattacccctccaacgaggacctgcacgagaggctg
gaggtgttcaaggcactcacggacaacgggagacacatcgcctacctggaggaggagctg
gccgagtttgtgctgcagtggatggacgtgggcttgtcctcggagttcctcctcgtgctg
gtgaacttggtcaagttcaacagctgttacctggacgaatacatcgcctccatggttcac
atgatctgcctgctctgcatccggacggcgtcctctgtcgacatagaggtctccctgcag
gtgctggacgccgtggtctgctacaactgcctgccggccgagagcctcccactgttcatc
gtcaccctgtgccgcactgtgaacgtcaaggagctctgtgagccctgctggaagctgatg
cgcaacctcctgggcacccacctgggccacagcgccgtctacaacatgtgccgtctcatg
gaggacagaacctacatggaggacgccccactgctgcgaggggctgtgttctttgtgggc
atggccctctggggagcccaccgcctctactcgctcaagaactcgccgacgtctgtcctg
ccgtccttttacgaggccatgacctgtcccaatgaggtggtgtcctatgaggtcgtcctg
tccgtaagcaggctcatcaagaagtacaggaaggagctgcaggccgtgacgtgggacctt
ctgctggacatcgttgagcgcctgctgcagcagctccagagcctggacagcccggagctc
aggaccatcgtccacgaccttctgaccacggtggaggagctgtgtgaccagaatgagttc
catggctcccaggagagatacttcgagctggtggagagatgtgcagaccagagacccgag
tcctccctcttgaatttagtctcctacagagctcagtcaattcacccagcaaaggacggc
tggattcagaacctgcagctgctgatggagcggttcttcaggaacgagacccgcagtgcc
gtgcgcatcaaggtgctggacgtgctgtccttcgtgctgctcatcaacaggcagttctac
gaggaggagctgatcaacacggtggtcatctcccagctctcccacatccccgaggataac
gaccaccaggtccggaagctggccacccagctgctggtggacctggccgaaggctgccac
actcaccacttcaacagcctgctggacgtcattgagaaagtgacggcccgctccctctct
ccacctcctgagctggacgagaggggcgcggctgcctactcggcctccctggaggacgtg
aagactgcggtcctggggctcctggtcatccttcagaccaagctgtacaccctgccggcc
agccacgccactcgtgtgtacgagacgctcgtcagccacctgcagctgcactacaagcac
aactacaccctgcccatcgccagcagcatccggctgcaggcattcgacttcctgctgctg
ctgcgcgccgactccctgcaccgcctgggcctgcccaacaaggatggggtggtgcggttc
agcccgtactgcctctgcgactacatcgagccggagcggagctctgagaagaaggccagc
ggccccctttcccctcccaccgggccgcctggccctgcacacgcaggccccgctgtgcgg
cttggctacctgccctactccctgctcttcggcctcctcctgcagtgcctgaagcaggag
acggactggaaggtgctgaagctggtgctcagcaagctgcccgagtctctgcgctacaag
gtgctcgtcttcacctccccctgcagcctcgaccagctgtcttccgcgctctgctccatg
ctttcaggcccaaagaccctggagcggctccggggcactccagaaggcttctgcaggacc
gacctgcacctggctgtggtcccagtgctcacggcgttgatctcctaccataactacctg
gacaagagcaagcagcgggagatggtgtactgcctggagcaagggctgatccaccgctgt
gccggccagtgcgtggtggccctggccgtgtgcagcgtggagatgcccgacatcatcatc
aaggccctgcccgtcctggtggtgaagctcacgcacatctccgccacagccagcatggcc
gtcccgctgctggagttcctgtccactctggcccggctgccgcacctctacaggaacttc
gccgcagagcagtacgccagcgtgttcgccatctcgctgccctacaccaacccctccaag
ttcaaccagtacatcgtgtgcctggcccaccacgtgatcgccatgtggttcatcaggtgt
cgcctgcccttccgcaaggacttcgtcccctacatcaccaagggcctgcgctccaatgtg
ctgatgtcttttgatgacacccctgagaaggacagcttcagagcgcggagcaccagcctc
aacgagcggcccaaaagtctgaggatagcccgagcccccagaccaggcttggcccactct
ccacccgtggacgagtgcaaggggagccccgccgccgaggccttccggtgccgcagcgtc
agtgtgtctgaacatggggtccgcaggatccagacgtcgctcaccagcgccagcctgggg
tccgcagatgagaactccatggcccaggctgacgacaacttgaaaaacctccacctggag
ctcacagaaacctgcctggacatgatggcccgatacgtgttctccaacttcacggccgtg
cccaagaggtcccccgtcggagagttcctcctggccggcggcaggaccaaaacctggctg
gtggggaacaagctcgtcacggtgacgacaagcgtggggactgggacccggtccctgctg
ggcctggattccggggagctgcagggcggcggcccagagttgagctctgaccctggcgtg
cacttgagacagacaaaggaggcaccggccaagctggagtcccaggccgggcagcaggtg
tcccgtggggcccgggaccgcgtccgttccatgtcgggaggccacggccttcgggtcggt
gccctggacccaccgacctcccacttccccggcagcccgtctgctccgggaacacaggct
gcgccagctgcgaagcctgacagggcctcagcaggcacccagggcccagcacaggagagg
acgaacctggcagcctacgtgcctctgctgacccagggctgggctgagatcttggtccgc
aggcccacagggaacacaagctggctgatgagcctggagaacccgctgagccccttctcg
tccgacatcaacaacatgcccctgcaggagctgtccaacgccctcatggcggccgagcgc
ttcaaggagcatcgcgacaccgccctgtacaagtcgctgtccgtgccggccgccagcaca
gccaggccccctcctctccctcgctctaacacagtggcctctctgtcctccctgtgcccg
tccagctgccaggggaagctgcacaggagcatttcctgggcagactcggcagtggtgctg
gaggagggcggtgcaggagaggcctccgggctggcggagcccccagagctggaggaccag
gggcactgcgggcgtgccggtgcctacagcaggtcgtcttcagcatctagccaggaggag
aagctgcacgcggaggatctggctgctgggggcgtccccatcgagcgggccgtgtcctct
gcgggcggccggccctcggtggacctgtccttccagccctcgcagcccctgagcaagtcc
agttcctcccctgagctgcagaccctgcaggacatcctgggggaccctggggacaaggtg
gacgtgggccggctcagtcctgaggccaaggcccggtcacagtcggggcttctggatgga
gacggtgctgcctgggcagctgctgacgaggagccccagggcctgggcccagcgcagcct
gagggtgccctggcctccggctcaccccgctcgcccggcggcctccggccccgaggatac
accatctccgattccgccccgtcgcgcaggggccggcgggcagacagggtggagagggac
accttcaagagcagagccgcggccaccaacgccgagaaagtagccggcatcaaccccagc
ttcgtgttcctgcagctctaccactcgcccttctttggcgacgactccaacaagcccatc
ctgctgcccaacgagtccttcgagcgctcggtgcagctcctggaccagattccgtcctac
gacacgcacaagatcgccgtgctgtatgtgggagagggccagagcaacagtgagctggcc
atcctgtccaacgagcacggctcctaccggtacgcggagttcctgacggggctcggcaag
ctcatcgaactcaaggactgccagcccgacaaggtgtacctgggcggcctggacgtgtgc
ggcgaggacggccagttcacctactgctggcacgacgacatcatgcaagccgtcttccac
atcgccaccctgatgcccaccaaggacgtggacaagcaccgctgtgacaagaagcgccac
ctgggcaacgacttcgtctccatcgtctacaacgactctggcgaggacttcaagctgggc
accatcagaggccagttcaactttgtgcacgtgatcatcacgccactggactacgagtgc
aaccttgtgtccctgcagtgcaggaaggacatggaaggcctggtggacaccagcatggcc
aagatcgtgtctgaccgcaacctcccgttcgtggcccgccagatggccctgcatgcgaac
atggcctcgcaggtgcaccacagccgctccaaccccaccgacatctacccctccaagtgg
atcgcccggctgcggcacatcaagcggcttcgccagcggatccgcgaggcggcccagtac
tccaactccagcctgccggtgctccacacgcacacgcccgcccacgccaaggccccagcc
caggcccccgccgagccggcgcccccctacgagacgggccagcgcaagcgcctcctctcc
tccgtggatgacttcacggagttcgtgtga

DBGET integrated database retrieval system