KEGG   Oryctolagus cuniculus (rabbit): 100351683
Entry
100351683         CDS       T03373                                 

Gene name
MDM4
Definition
(RefSeq) MDM4, p53 regulator
  KO
K10127  protein Mdm4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100351683 (MDM4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100351683 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100351683 (MDM4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100351683 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB Prok-RING_4 Cript
Other DBs
NCBI-GeneID: 100351683
NCBI-ProteinID: XP_002717619
Ensembl: ENSOCUG00000000005
UniProt: G1SCE0
LinkDB
Position
16
AA seq 491 aa
MTSLSTSAQCSASESACGISTERINQVRPKLPLLKILQAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVSLATATTDAAQTL
ALAQDHSMDIPSQDQLKQCAEGSSSSRKRAEENNVPTLPTSQHKRRNSREDEDLIENLTQ
EETSRLDLGFEEWDVAGLPWWFLGNLRNNYTPRSNGSTDLQTNQDIGTAVVSDTTDDLWF
LNESVSEQLGVGIKGEAALTDQASEEVGKVGDKKMIEERKSDDPEDSKSLSDDTDVEVTS
EDEWQCTECRKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKKENEGIDV
PDCRRTISAPVVRPKDVYRKEENSKLFDPCSSVEFLDLAHSSESQETISSMGEQADHLFE
QRTDTENMEDCQNILKPCSLCEKRPRDGNIIHGRTSHLTTCFHCARRLKKTGASCPICKK
EIQLVIKVFIA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgacatcactttctacttctgcccagtgttcagcatccgagagtgcttgcgggatctct
acagaacgaatcaatcaggtacgaccaaaactgccgcttttgaagatcttgcaggcagca
ggtgcacaaggtgaaatgttcactgttaaagaggttatgcactacctaggccagtatata
atggtgaagcagctttatgatcagcaggagcagcatatggtgtactgtggtggagatctt
ttgggagagcttctaggacggcagagcttctctgtgaaagatccaagccccctctatgat
atgctaagaaagaatcttgtctctttagccactgctactacagatgccgctcagactctc
gctctcgcacaagatcacagtatggatattccaagtcaagaccaactgaagcaatgtgca
gaggggagttccagttccaggaaaagagccgaagaaaacaatgttcccacactgcctacc
tcacagcataaacgcagaaactctagagaagatgaagacttgatagaaaatttaacccaa
gaggagacatctaggctggaccttgggtttgaggagtgggatgtagctggcctgccttgg
tggtttttaggaaacttgagaaacaactatacacctagaagtaatggctcaactgactta
cagaccaatcaggatataggtactgccgttgtttcagacactacagatgacttgtggttt
ttgaatgagtcagtatcagagcagttaggtgttggaataaaaggtgaagctgctcttact
gatcaagcaagtgaagaagtaggaaaagtgggtgacaaaaagatgattgaagagaggaaa
agtgatgaccctgaggactcgaagtccttaagtgatgacactgatgtagaagtcacctct
gaggacgagtggcagtgcactgagtgcaggaagtttaactctccaagcaagaggtactgt
tttcgatgctgggccttgaggaaagattggtattcagattgttctaagttaacccattct
ctctccacgtccgatatcactgccatacctgaaaagaaggaaaatgaaggaattgatgtc
cctgattgtcgaagaaccatttcagctccggttgttagacctaaagatgtttatagaaag
gaagaaaactccaaactttttgatccctgcagctcggtggaattcttagatttggctcat
agttccgaaagccaagagaccatctccagcatgggagaacaagcagatcacctttttgag
cagaggacagatacagaaaacatggaggactgccagaacatcttgaagccgtgcagctta
tgtgagaaaagaccccgagatgggaacatcattcacgggaggacgagccaccttaccact
tgtttccactgtgcgagaagactaaagaagactggggcttcgtgccctatttgcaagaaa
gagattcagttggttattaaggttttcatagcatag

DBGET integrated database retrieval system