KEGG   Oryctolagus cuniculus (rabbit): 100352015Help
Entry
100352015         CDS       T03373                                 

Gene name
IQCA1L
Definition
(RefSeq) IQ motif containing with AAA domain 1 like
Organism
ocu  Oryctolagus cuniculus (rabbit)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ AAA_16 RsgA_GTPase AAA_5
Motif
Other DBs
NCBI-GeneID: 100352015
NCBI-ProteinID: XP_008262159
LinkDB All DBs
Position
13
AA seq 730 aa AA seqDB search
MPGFWNRGKRQEGTCEKRTATRGRPWRCRSPKYFLLEQNSAIKERGLILAEILSRMRPAS
VEEAPPVMHRTDAIILAQRAERARQGRLRATFMREIRKEEERDRKSREEGRHKFTQDQSA
VIIQKVWKGYLQRKRTQLDRRREMEFIGMLPSANQVEHFGIITQASFGEDIRRLRQREKE
EEFQQALVKAHETLTETEGPDMKEKMKEQIRQWFIECHALTGRFPDYPDEASGGSYLIFA
DKTPEQVRMELEVQDKENKKKEQDKNKENETEKKEKKKKGKEERAKKGEAETVLKVSPSR
FVPVINAGHEEYISLWKNRNDGLYPSQSFDSESLREEKRKEVELEIRIQVDELMRQELKN
LRLAVDKEEERPVKPPRKKSKKKLGKKKKEKDLTSDRSLDSLYEELVIMGLIKKNEKVAL
KDYIGDCLYLGATLNLARKLPMPSLFDVRQNVALYGVLRLGSPDIHSMAPLIRSILLVGP
SGMGKKMLVNAVCTETSANLFDLSPNNLQGKCSGKNGVQMIVHMVFKVARLLQPSVIWIG
NAEKNFYKKVPKEERKMDPKRIKKDLTRAVRLLAPGDRVMLIGTTSRPQLAEMKGLCRVY
ERVLFIPRPDYASRFVLWKHMIEAQGVQVTQSLDVSALAKVSDGYTPANILQATQLVLNE
RRLLQLSKRPLVASEFLGYLAKMDPVYKEEEESMKEWYFKTPLGRKNVKLGKEQMEAEEA
KLAREKKKKK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgccagggttctggaaccgagggaaacggcaggagggaacatgtgagaagcggacagca
acaaggggcagaccctggaggtgccgatcccccaaatacttcctcctggagcagaacagt
gctatcaaagagcgagggctgattctggctgagatcctgtcccgaatgcgtccagcgtct
gtggaggaggcccctccagtgatgcaccggactgatgccatcattctagcgcaacgcgct
gagcgggccaggcagggccggctccgggccactttcatgcgagagattcggaaagaggag
gagcgggatcgcaagagtcgggaggaggggcggcacaaattcactcaagaccagtcagct
gtcatcatacagaaggtgtggaagggctacctacagaggaaacgcacccagctggaccgc
cgcagagagatggaattcattggcatgctcccctcggccaaccaggtggagcactttggc
atcatcacgcaagcatcctttggggaggatattcgcaggctgcgacagagggagaaggag
gaggagttccagcaggcgctggtgaaggcccatgagaccctcaccgagaccgaggggccg
gacatgaaggagaaaatgaaggagcagattcgacagtggtttatcgagtgccatgccctt
acaggtcggttccctgactatccagatgaggcttcagggggatcctacctgatctttgca
gacaagactccagaacaggtgagaatggaactggaggtacaggacaaggagaacaaaaaa
aaggagcaagacaaaaataaggaaaatgagacggagaaaaaagagaagaagaagaaaggg
aaggaagaaagagctaagaagggggaggcggaaacagtgctgaaagtgtcaccatccaga
tttgtacctgtgattaatgctggacatgaggagtatataagcctgtggaagaaccggaat
gacggcttgtaccccagtcagagctttgactccgagagcctccgggaggagaagaggaag
gaagtggagctggaaattcgcatccaggtggatgagctgatgcgccaggagctgaagaac
ctgcgtctggctgtggacaaggaggaggagagacctgtgaagcctccaaggaaaaagtct
aagaagaaacttgggaagaagaagaaagagaaagatctgacctcagacaggtccctggac
tctctgtatgaagagcttgtcattatgggcctcataaagaagaatgagaaagtggcatta
aaagattatattggtgactgcctctaccttggagctactctgaacttggcaagaaagttg
cctatgccctccctgtttgatgttcgacagaacgtggccctgtatggggtccttcggcta
ggatcccctgacattcactccatggctcctctcatccgctccatcctgctggtgggcccc
tccggcatggggaagaagatgcttgtcaatgctgtgtgcacagaaaccagcgccaacctg
ttcgacctatcgcccaacaacctgcagggcaaatgctcgggcaagaatggggtgcagatg
atagtgcacatggtcttcaaggtggcccggctcctgcagccgtccgtgatctggattgga
aatgctgagaagaacttctataagaaggtcccgaaggaagagaggaagatggacccaaag
cgaattaagaaggacctcaccagggccgtacggctgctggctcctggagaccgtgtgatg
ctgatagggacaaccagtaggccacagctggccgaaatgaaagggctgtgccgggtctat
gagcgagtcctcttcatcccgcggcctgactatgcttctcgctttgtgctctggaagcat
atgatagaggcccagggagtccaggtgacccaaagcctggacgtcagtgccctggccaag
gtgtctgatggctacacacccgctaacattctccaagccacccagttggtgctgaatgag
cggcggctcctgcagctctccaagcggcccctggtggcctcagagttcctggggtacctg
gcgaagatggatcctgtgtataaggaggaggaggagtccatgaaggaatggtacttcaag
accccactgggcaggaagaacgtgaaactcggcaaagagcagatggaggccgaggaggcc
aagttggccagggagaagaagaaaaagaagtga

DBGET integrated database retrieval system