KEGG   Oryctolagus cuniculus (rabbit): 100352107Help
Entry
100352107         CDS       T03373                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00730  Thiamine metabolism
ocu00790  Folate biosynthesis
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100352107
   00790 Folate biosynthesis
    100352107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352107
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100352107
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100352107
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100352107
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Enzymes
  100352107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100352107
NCBI-ProteinID: XP_002721502
Ensembl: ENSOCUG00000009528
LinkDB All DBs
Position
Un
AA seq 537 aa AA seqDB search
MQGAWLLSVLPLLLLGPRPQPALGVIPEEEEHPDFWNKKANEALTNAKKLQPIQTTAKNL
ILFLGDGLGVPTVTATRILKGQMTGNLGPETPLAMDHFPYLALSKTYNVDRQVPDSAGTA
TAYLCGVKANYGTIGLSAAARYDQCNTTQGNEVLSVMYRAKKAGKSVGVVTTTRVQHASP
AGTYAHTVNRNWYSDANMPASARQEGCQDIASQLVSNMDIDVILGGGRKYMFPKGTPDPE
YPTDPSQNGTRLDGRNLVEEWLTCLAVSLQGARYVWNRTELLQTTQDPSVTQLMGLFEPS
DMKYETQRDPERDPSLMEMTEAALHLLRQNPRGFYLFVEGGRIDHGHHAGNAFRALTEAV
MFDSAIERAGQLTSEQDTLTLVTADHSHVFTFGGYTLRGSSIFGLAPDKAQDGKNYTSIL
YGNGPGYAVSNGIRPDVTQNDTSDPEYLQQAAVPLSSETHGGEDVAVFARGPQAHLVHGV
QEQSYIAHVMALAACLEPYTDCDVTPPNGACPAPAAGPWLTVLATTLLLLLGAAAAP
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggcctggctgctgtcggtactgccgctgctgctgctgggccccaggcctcag
cctgccctgggtgtcatcccggaggaagaggagcacccagatttctggaacaaaaaggca
aatgaggctctgaccaatgccaagaagctgcagcccatccagacgaccgccaagaacctc
atcctcttcctgggagacgggttgggtgtgcccacggtgacggccacaaggatcctgaaa
gggcagatgactggcaacctgggacccgagacgcccctggccatggaccacttcccatac
ctggctctgtccaagacatacaacgtggacagacaggtgcccgacagcgctggcacagcc
acagcctacctgtgcggggtcaaggctaactatgggaccatcggcctgagtgcggccgcc
cgctacgaccagtgcaacacaacccagggcaatgaggtgctctcggtgatgtacagggcc
aagaaggcagggaagtccgtgggggtggtgaccaccacgcgggtgcagcacgcctcgcca
gctggcacctacgcacacacggtgaaccgcaactggtactcggacgccaacatgcctgcc
tcagcacggcaggagggctgccaggacatcgcctcacagctggtctccaacatggacatc
gacgtgatcctgggtgggggccgcaagtacatgtttcccaaggggaccccagaccctgag
tacccaactgaccccagccagaacgggaccaggttggatgggcggaacctggtggaggag
tggctgacatgtctggctgtgtccctccagggggcccggtatgtgtggaaccgtacagag
ctcctgcagaccactcaggatcccagcgtgacccagctcatgggcctctttgagccctca
gacatgaagtatgagacccagagagaccctgagcgggacccctccctgatggagatgact
gaggccgcactgcacctgctgcgccagaacccccgcggcttctacctcttcgtggagggg
ggccgcatcgaccatggtcaccacgcaggcaatgcttttcgggcgctcactgaggccgtc
atgttcgactccgccattgagagggcgggccagctcaccagcgagcaggacacgctgacc
ctggtcactgccgaccactcccacgtcttcacctttgggggctacacactgaggggcagc
tccatcttcgggctggccccagacaaggcccaggacggcaagaactacacctccatcctg
tatggcaacggcccaggctacgctgtcagcaatggtatacggcccgatgtcacccagaac
gataccagtgaccccgagtacctgcagcaggcagccgtgcccctgtcgtccgagacccac
ggcggcgaggacgtggctgtgtttgcgcgcgggccgcaggcgcacctggtgcacggcgtg
caggagcagagctacattgcgcacgtcatggccctcgcggcctgcctggagccctacacg
gactgtgatgtgacgccccctaatggggcatgccccgcgccagccgcgggcccctggctg
acagtgctggccacaaccctcttgctgctcctgggagcagctgctgcaccctga

DBGET integrated database retrieval system