KEGG   Oryctolagus cuniculus (rabbit): 100352110
Entry
100352110         CDS       T03373                                 

Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100352110
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100352110
   04623 Cytosolic DNA-sensing pathway
    100352110
   04625 C-type lectin receptor signaling pathway
    100352110
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100352110
   05135 Yersinia infection
    100352110
   05133 Pertussis
    100352110
   05134 Legionellosis
    100352110
  09172 Infectious disease: viral
   05164 Influenza A
    100352110
SSDB
Motif
Pfam: CARD PYRIN
Other DBs
NCBI-GeneID: 100352110
NCBI-ProteinID: XP_002721796
Ensembl: ENSOCUG00000004495
UniProt: G1SLX6
LinkDB
Position
Un
AA seq 196 aa
MGRARDAILEALENLTADEFKKFKHKLLSVPLREGYGRIPRGTLLSMDAVDLTDKLVSFY
LETYGAELTAAVLRDMGMQESAEQLEELLSQGSGAAPAAGIKAHSEKIAKPALHFVDQHR
AALISRVTDVDGVLDVLHGRVLTEEQYQAVRAETTNPNKMRKLFSFAPAWDLTCKDLLLQ
ALRDTQPYLVADLEPR
NT seq 591 nt   +upstreamnt  +downstreamnt
atggggcgcgcgcgggacgccatcctggaggctctggagaacctgaccgccgacgagttc
aagaagttcaagcacaagctgctgtccgtgccgctgcgagaaggctacggacgcatcccg
cggggcacgctgctgtccatggacgccgtggacctcaccgacaagctggtcagcttctat
ctggagacctacggcgctgagctcacagcggccgtgctgcgtgacatgggcatgcaggag
tcggcggagcagctggaggagctcctgagccaaggctctggagctgcccccgccgccggg
atcaaggcccattctgagaagattgccaagccagcgctgcatttcgtggaccagcaccgg
gcagccctcatctccagagtcacagatgtggacggggtgctggacgtgctgcacgggagg
gtcttgacggaggagcagtaccaggcggtgcgggccgagaccaccaacccaaacaagatg
aggaagctcttcagcttcgctccagcctgggacctgacatgcaaggacctgctcctccag
gccctgagggacacccagccctacctggtggccgacctggagccgagatga

DBGET integrated database retrieval system