KEGG   Oryctolagus cuniculus (rabbit): 100352148Help
Entry
100352148         CDS       T03373                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100352148 (TGM2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100352148 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 100352148
NCBI-ProteinID: XP_008254228
Ensembl: ENSOCUG00000003636
LinkDB All DBs
Position
4
AA seq 687 aa AA seqDB search
MAEDLILERCDLELEANGRDHHTADLCQDRLVVRRGQPFWLKLHFEGRSYEAGVDTLTFS
AVTGPAPSEEAGTKARFPLSDAVEEGAWTASVVDQQDGVLSLQLSTPATAPIGLYRLSLE
ASTGYQGSSFVLGHFTLLFNTWCPADAVYLDSEEERREYVLTQQGFIYQGSAKFIKSVPW
NYGQFEDGILDTCLMLLDINPKFLKDSGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLQGR
WDNNYGDGVSPMFWIGSVDILRRWRDYGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGELQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQEDGSMHKSINHSL
VVGLKISTKSVGRDEREDITHNYKYPEGSQEERDAFTRANHLNKLAEKEETGVAMRIRVA
ESMSMGSDFDVFAHITNDTAEDRACRLVLCARTVSYNGVLGPECGTKDLLGLALEPYSEK
SIPLRILYEKYRDSLTQSNLIKVQGLLIEPAANSYVLAQRDIYLENPEIKIRVLGEPKQN
RKLVAEVSMRNPLTVPLTGCSFTVEGAGLLREQKTVEIPDPVEPEEVVKVRVDLLPLHVG
LSKLVVNFESDKLKSVKGFRNIIIGPS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctgatcctggaaagatgcgacctggagctggaggccaatggccgcgac
caccacacggccgacctgtgccaggacaggctggtggtgcggcggggccagcccttctgg
ctgaagctgcacttcgagggccgcagctacgaggctggcgtggacaccctcaccttcagc
gccgtgactggcccagcccccagcgaggaggcggggaccaaggctcgcttcccgctgtcc
gatgccgtggaggagggtgcctggacggcctcggtggtggaccagcaggacggcgtcctg
tcgctgcagctcagcaccccggccaccgcccccatcggcctgtaccgcctcagcctggag
gcctccaccggctaccagggctccagcttcgtgcttggccacttcaccctgctcttcaac
acctggtgcccagccgatgccgtgtacctggactcggaggaggagaggcgggagtacgtg
ctcacgcagcagggcttcatctaccagggctcggccaagttcatcaagagcgtcccttgg
aactatgggcagtttgaggacgggatcctggacacctgcctgatgctcctggacatcaac
cccaaattcctgaaggactccggccgcgactgctcgcgccgcagcagccccgtctacgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggcgtgctccagggacgc
tgggacaacaactacggcgacggcgtcagccccatgttctggatcggcagcgtggacatc
ctgcggcgctggagagactacggctgccagcaggtcaagtacggccagtgctgggtcttc
gctgccgtggcctgcaccgtgctgcggtgtcttggcatccccacccgcgtggtgaccaac
tacaactcggctcatgaccagaacagcaacctgctcatcgagtacttccgcaacgagttc
ggggagctccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggcctgacctgcagcccggctatgaggggtggcaggccctcgacccgacg
ccccaggagaagagtgaagggacatactgctgtggccccgttccggttcgcgccatcaag
gagggtgacctgagcaccaagtacgacgcaccttttgtcttcgccgaggtcaacgccgac
gtggtggactggatccagcaggaagatgggtccatgcacaaatccatcaaccactccctg
gtggtggggctgaagatcagcacgaagagtgtaggccgcgatgagcgtgaggacatcacc
cacaactacaagtacccggaggggtcccaggaggagagggacgccttcaccagggccaat
cacctgaacaagctggccgagaaggaggagacgggggtggccatgaggatccgcgtggcc
gagagtatgagcatgggcagcgacttcgatgtcttcgcccacatcaccaacgacacggcc
gaggaccgcgcctgccgcctcgtgttgtgtgcccgcaccgtcagctacaacggggtcctg
gggcccgagtgtggcaccaaggacctgctcggcctcgccctggagccctactctgagaag
agcatccccctgcgcatcctgtacgagaagtaccgggacagcctgacacagtctaacctc
atcaaggtgcagggcctcctcatcgagccagctgccaacagctacgtgctggcccagagg
gacatctacctggagaatcccgaaatcaagatccgggtgctgggagagcccaagcagaac
cgcaagctggtggccgaggtgtccatgaggaacccgctcacggtgcccctgacaggctgc
tccttcacagtggagggggccggcctgctcagggagcagaagacggtggagatcccagac
cccgtggagccagaggaggtggtcaaggtgagggtggacctgctgccgctgcacgtgggc
ctgagcaagctggtggtgaacttcgagagcgacaagctcaagtccgtgaagggcttccgg
aacatcataatcggcccctcctaa

DBGET integrated database retrieval system