KEGG   Oryctolagus cuniculus (rabbit): 100352218
Entry
100352218         CDS       T03373                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03460  Fanconi anemia pathway
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100352218 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352218 (POLK)
   05202 Transcriptional misregulation in cancer
    100352218 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100352218 (POLK)
   05212 Pancreatic cancer
    100352218 (POLK)
   05225 Hepatocellular carcinoma
    100352218 (POLK)
   05226 Gastric cancer
    100352218 (POLK)
   05214 Glioma
    100352218 (POLK)
   05216 Thyroid cancer
    100352218 (POLK)
   05220 Chronic myeloid leukemia
    100352218 (POLK)
   05217 Basal cell carcinoma
    100352218 (POLK)
   05218 Melanoma
    100352218 (POLK)
   05213 Endometrial cancer
    100352218 (POLK)
   05224 Breast cancer
    100352218 (POLK)
   05222 Small cell lung cancer
    100352218 (POLK)
   05223 Non-small cell lung cancer
    100352218 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100352218 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100352218 (POLK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100352218 (POLK)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100352218 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 100352218
NCBI-ProteinID: XP_002723070
Ensembl: ENSOCUG00000002900
LinkDB
Position
Un
AA seq 855 aa
MEEQHSYGEDLLLRVGLNDNKAGMEGLDKEKINRIILEATKGSRFYGNELKKEKQVNQRI
EKMLQQKAQITNQQLRKAQLQVDRFAMELEKSRNLSNTIVHVDMDAFYAAVEMRDNPELK
DKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSQEVKEI
LADYDPDFMAMSLDEAYLNITKHLEERQHWPEDKRRYLSQMGNSADDDMPSKEVDVLCEQ
DRAISPLLFEDSPPDLQPLQGNSGEQNNPQILHNSVVFGTSAEEVVKEIRFRIKQKTTLT
ASAGIAPNTMLAKICSDKNKPNGQYQVIPNRQAVMNFIKDLPIRKVSGIGKVTEKMLKAL
GVVTCTELYQQRALLSLLFSETSWHYFLHVSLGLGSTHLARDGERKSMSIERTFSELSKA
EEQYSLCQELCRDLAQDLQKEGLKGRTVTVKLKNVDFEVKTRASTVPCLVSTSEEIFAVA
KELLRTEIDADFPHPLRLRLMGVRVSGFPNEEDKKQQQKSIVGFLQTGNHVLPATGPVLE
RTGMGPPENPLEVSQKKSFFDKKRLERKGSHQDTLKHEAADEQSLQTSQPLPVLQKMSEN
LALESAGGLGTFTCPVCSREQGRISLEAFNRHVDACLDAPSGSAASRGALGSQAASTEVS
RKENAHHSFSCGETQDDQENVDMASVGLEESTGNSSEVQSADALNHKHKEECDGLPDKSF
SMEHGRQNSSCSVALEKEDPGPLGGQECPQPYLYEVAAGQALVCPVCNLEQRTSDLTLFN
VHVDVCLNKDVIQELRNDSVNPVHQLKENSRNAGNSSRAQKTLAKTKRPALMKKNSASKK
VKPSSATRTLDIFFK
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggaggagcagcacagttatggagaggaccttctgcttagggtgggacttaatgacaac
aaagcaggaatggaagggttggataaagagaaaattaacagaattatattggaagccaca
aagggatctagattttatggaaatgagctcaagaaggaaaagcaagttaaccagcgaatt
gaaaaaatgttgcagcaaaaagctcaaataaccaaccagcagctaaggaaagcacagcta
caggttgacagatttgcaatggaattagagaagagccggaatctgagcaacaccatagta
catgttgacatggacgctttctatgctgctgtggagatgcgggacaacccggaactgaag
gacaagcccattgctgtgggctcaatgagtatgttgtctacttcaaattaccatgcaaga
aggtttggtgtccgtgcagccatgccaggatttattgccaagcgactgtgcccacagctt
attatagtgccccccaacttcgacaagtatcgagccgtgagtcaggaggttaaggaaata
cttgctgattatgatcctgattttatggccatgagcctggatgaagcctacttgaatatc
acaaagcacttagaggaaagacagcactggccagaggacaaaagaaggtacctctcccag
atggggaactctgcagacgatgatatgccaagcaaggaagtggatgtgctgtgtgaacag
gaccgggccatctccccactcctttttgaagacagcccccctgacttgcagcctttgcaa
gggaattctggagaacaaaacaatcctcaaatactccacaactccgttgtttttggaaca
tcagcagaggaagtggtaaaggaaattcgtttcagaatcaagcaaaaaacaacactgaca
gccagtgcaggcattgcccccaatacaatgttagcaaaaatatgcagtgataagaataaa
ccaaatggacaataccaagttatccccaacagacaagctgtgatgaacttcatcaaggac
ttacccataaggaaggtttccggaataggaaaagttacagagaaaatgttaaaggctctc
ggagttgtcacttgcacagaactctaccaacagagagcattactttctctacttttctcc
gaaacgtcttggcattattttcttcatgtctccctgggtctaggttcaacacacctggca
agggatggagagaggaaaagtatgagtattgagagaacattcagtgagctaagcaaagca
gaagaacagtacagcctgtgccaggaactatgcagggatcttgctcaggatctccagaaa
gaaggactgaagggtagaactgtcactgtgaagctgaagaacgtggattttgaagtaaag
acgcgagcgtctacagttccatgtcttgtttctacttcagaagaaatctttgctgttgcc
aaggagttgctaaggacagagattgatgctgattttccacatcccttgagattaagactt
atgggtgttcgggtgtctggttttcccaacgaagaggacaagaagcagcagcaaaagagc
atcgtcggcttcctacagactggaaaccacgtcctgcccgccacagggcctgtgctagag
agaactggcatgggtccgcctgaaaaccctctagaagtgtctcagaagaagagtttcttt
gataaaaaacgattagaaaggaaagggagtcaccaagacacattgaaacatgaagctgca
gatgaacagagtttgcagacctcacagccactgccagttttacagaagatgagtgagaat
ttagcgttggagagtgcgggtggccttggcaccttcacctgtcctgtttgctccagggag
cagggacgcatcagtctggaagccttcaacaggcacgtggatgcgtgtctcgatgcacct
tcaggcagcgcggcctccaggggggccctgggctcacaggctgcctccactgaagtcagc
aggaaagaaaatgcacatcactctttctcgtgtggggagacgcaggatgatcaggaaaat
gtcgacatggcttcagtaggtttggaagagtctacaggtaactcatctgaggtacagagt
gcagacgctctgaatcataagcacaaggaggagtgtgatggtcttccagacaaatccttc
agtatggaacacggtcgccagaattcttcttgcagtgttgcactggaaaaggaagatcct
gggccgttaggtgggcaagaatgcccccagccttatttatatgaagtggcagcaggccaa
gctctagtatgtcctgtttgtaacctagaacaaaggacttcagatcttaccctgttcaat
gtgcacgtggatgtctgcttaaataaagatgttatacaagaactgagaaacgattcggtt
aatcctgttcatcaactcaaagaaaattctagaaatgctggcaactcaagcagagcacag
aagacgttagcaaaaacaaaaaggccagcactgatgaaaaagaactcggcatcaaagaaa
gtaaagccaagcagtgccacacgtacccttgatatattttttaagtga

DBGET integrated database retrieval system