KEGG   Oryctolagus cuniculus (rabbit): 100352362
Entry
100352362         CDS       T03373                                 

Gene name
FUS
Definition
(RefSeq) FUS RNA binding protein
  KO
K13098  RNA-binding protein FUS
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100352362 (FUS)
  09122 Translation
   03013 RNA transport
    100352362 (FUS)
   03015 mRNA surveillance pathway
    100352362 (FUS)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100352362 (FUS)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100352362 (FUS)
   05022 Pathways of neurodegeneration - multiple diseases
    100352362 (FUS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ocu03041]
    100352362 (FUS)
Spliceosome [BR:ocu03041]
 Complex A
  Other components
   Complex A specific factors
    100352362 (FUS)
SSDB
Motif
Pfam: zf-RanBP RRM_1
Other DBs
NCBI-GeneID: 100352362
NCBI-ProteinID: XP_008246922
LinkDB
Position
Un
AA seq 517 aa
MASNDYTQQATQSYGAYPTQPGQGYSQQSNQPYGQQSYSSYGQSADTSGYGQSSYGSSYG
QTQNTGYGAQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSNTSGSYGGSSQS
SSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGGSYGQ
DQSSMSGGGGGYGSQDQSGGGGGYGGGQQDRGGRGRGGGGGYNRSSGGYEPRGRGGGRGG
RGGMGGSDRGGFNKFGGKPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIG
IIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFA
TRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCP
NPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGSYGDDRRGGRGGYDRGGYRGRGG
DRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcctcaaacgactatacccagcaagcaacccaaagctacggggcctaccccacccag
cctgggcagggctactcccagcagagcaatcagccctacggacagcagagttacagcagc
tacgggcagtcagcagacacttcaggctatggccagagcagctacggttcttcttacgga
cagacccagaacacaggctatggcgctcagtcagctccccaggggtatggctcaactggc
ggctatggcagcagccagagttctcaatcatcctatgggcagcagtcttcgtaccctggc
tatggacagcagccagctcccagcaacacctccggcagttacggcggcagttctcagagc
agcagctatgggcagccccagagtgggggctatggccagcagtctggctatggcggacaa
cagcaaagctatggacagcagcaaagctcctataatccccctcagggctacggacagcag
aaccagtacaacagtagcagcggaggtggtggagggggtggcggagggagctacggccaa
gatcagtcctccatgagcggtggtggcggtggttatggcagtcaggaccagagtggcggc
ggcggtggctacgggggaggccagcaagaccgtgggggccgcggcaggggcggcggcggc
ggttacaaccgcagcagtggtggctatgagcccagaggacgtggaggtggccgtggaggc
agaggcggcatgggcggaagtgaccgtggtggcttcaataaatttggtggtaagcctcgg
gaccaaggatcacgtcatgactcagaacaggataattcagacaacaacaccatctttgtg
caaggcctgggcgagaatgtcaccatcgagtctgtggctgactacttcaagcagattggc
attattaagacaaacaagaaaacaggacagcccatgattaatttgtacacagacagggaa
actggcaagctgaagggagaggcaacagtctcatttgatgacccaccttctgctaaagcg
gccattgactggtttgacggtaaagaattctctgggaatcctatcaaggtctcgtttgct
actcgccgagcggacttcaatcggggtggtggcaatggtcgtggaggccgagggcgagga
ggtcccatgggccgtggaggctacggtggcggcggcagtggaggcggtggccgaggagga
ttccccagtggaggtggtggtggcgggggacagcagagagccggggactggaagtgtcct
aatcctacctgtgagaacatgaacttctcttggaggaatgaatgcaaccagtgtaaggcc
cctaaaccagatggcccaggagggggaccaggaggttctcacatggggggtagctatgga
gatgaccgtcgtggtggccgaggaggctacgatcggggcggctaccggggccgtggcggg
gaccgtgggggcttccgagggggccggggtggtggggacagaggcggctttggccctggc
aagatggactccaggggtgagcacagacaggatcgcagggagcggccgtattag

DBGET integrated database retrieval system