KEGG   Oryctolagus cuniculus (rabbit): 100352497Help
Entry
100352497         CDS       T03373                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00052  Galactose metabolism
ocu01100  Metabolic pathways
ocu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100352497 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100352497 (LCT)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     100352497 (LCT)
    3.2.1.108  lactase
     100352497 (LCT)
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   100352497 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 100352497
NCBI-ProteinID: XP_002712474
Ensembl: ENSOCUG00000000293
UniProt: G1SD00
LinkDB All DBs
Position
7
AA seq 1925 aa AA seqDB search
MELFWSIVFTVLLSFSCRGSDWESDSNFISAAGPLTTDLLLSLQYPQGNQTSDFAAGGKD
LYVCSQPLPAFLPEYFSSLHASEITHYKVFLSWAQLLPAGRSGDPDENAVRCYRQLLEAL
RAAQLQPMVVLHHQPLPASSALRSDVFANLFAEYATFAFHAFGDLVGVWLTFSDLEAAIR
ELPQQESRAWRLQLLTEAHRKAYEIYHQKYAAQGGKVSVVLQAEEISELLLESSTSALAK
DSIDFLSLDLSYECQSETSLPEKLSKLQTIEPKVKVFIFTLRLQDCPSSRKSPASLLFSF
IEAINKDQMLTLGFDVNVFLRCSSTSKKSISCFLTDSLALQTDHERAARNSAPASAYQRV
WEMFAHQPRAERDAFLQDAFPQGFLWGVSTGAFNVEGGWAEGGRGPSVWDQFGHLKAAQG
QATPEVASDSYYKWASDVALLRGLRAQVYKFSISWSRIFPMGRGSSPSPQGVAYYNKLID
SLLDSHIEPMATLFHWDLPQALQDEGGWQNESVVDAFVDYAAFCFSAFGNRVKLWVTFHE
PWVMSYAGYGTGQHAPGISDPGIASFQVAHLVLKAHARTWHHYNSHHRPQQQGRVGIVLN
SDWAEPLSPERPEDLAASERFLHFMLGWFAHPIFVDGDYPATMKAQIQQRNEQCPSPVAQ
LPEFTDTEKQLLKGSADFLGLSHYTSRLISKAPEDSCIPSYDTIGGFSQHTDPAWPQTSS
PWIRVVPWGIRRLLQFVSLEYTKGKVPIYLAGNGMPIGESENLLNDSLRVDYFNQYINEV
LKAIREDSVDVRSYIARSLMDGFEGPAGYSQRFGLYHVNFNESSKPRTPRKSAFLLTSII
EKNGFLTKAVKQPLPPNSAHLPSKTRASALPSEVPSKAKVVWEKFSNQTKFERDLFYHGT
FRDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGNGVTDSSTGDIACDSYNQLDAD
LNVLRALKVKAYRFSLSWSRIFPTGTNSSINSHGVDYYNRLIDGLLASDIFPMVTLFHWD
LPQALQDIGGWENPSLIDLFDSYADYCFQTFGDRVKFWITLNEPTYYSWWSYGSGTFPPN
VNDPGWAPYRISHALIKAHARVYHTYDEKYRQSQNGVISLSLVAQWAEPKSPDVLRDVEA
ADRKMQFTLGWYAHPIFKTGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKSYIRGTAD
VFCLNTYSSKIVQHKTPALNPPSYEDDQELAEEEDTSWPTTAMNRAASFGMRRLLNWIKE
EYGDIPIYITENGVGLTNPRLEDIDRIFYYKTYINEALKAYRLDGVNLRGYFAWSLMDNF
EWLRGYTVKFGLYHVDFEDVNRPRTARISAGYYTELITNNGMPLPSEDEFMYGQFPEGFI
WSAATSAYQIEGAWRADGKSLSIWDTFTHTRLRIENDDIADVACDSYHKISEDVVALQNL
AVTHYRFSISWSRILPDGTTNYINEAGLNYYVRLIDALLAANIKPQVTLYHWDLPQALQD
VGGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPYVIANQGYGYGVSAPGISFRPGT
APYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQEDVEAANRYVQ
FLGGWFAHPIFKNGDYNEVMKTRIRERSLAAGRNVSRLPEFTESEKRRINGTYDFFGFNH
YTTVLAYNLNYPIISSYDADRGVASIVDRSWPDSGSFWLKMTPFGFRRILNWIKEEYNNP
PIYVTENGVSHRGDSYLNDTTRIYYLRSYINEALKAVQQDKVDLRGYTVWTLMDNFEWAT
GFSDKFGLHFVNYSDPSLPRIPRESAKFYASIVRCNGFPDPAEGPHPCLLQPEDTDPTMS
PVSQEEVQFLGLSLGSTEAETALYVLFSLMLLGVCGLAFLSYALCKSSKQRKKLSQQELS
PVSSF
NT seq 5778 nt NT seq  +upstreamnt  +downstreamnt
atggagctcttttggagtatagtctttactgtcctcctgagtttctcctgccgggggtca
gactgggaatctgatagcaatttcatttcagctgcagggcctctaaccactgacctactg
ctcagcctgcagtatccacagggaaaccagacttctgattttgcagcagggggcaaagac
ctttatgtttgttcccagccactgcccgctttcctgccagagtatttcagcagtcttcat
gccagtgagatcacccattataaagtgtttctgtcgtgggcacagcttctcccagcagga
cgctccggagacccagatgagaacgcagtgcggtgctaccggcagctccttgaggccctc
agggctgcgcagcttcagcccatggtcgtcctgcaccaccagcccctccctgccagcagt
gccctgaggagtgacgtcttcgccaacctcttcgctgagtatgccaccttcgccttccat
gcctttggggacctcgtgggggtctggctcacctttagtgacttggaggcagccataagg
gagctccctcagcaggagtcaagagcttggcgtctccagctcctcactgaggcccacaga
aaagcctatgagatttaccaccaaaagtatgctgctcagggaggaaaggtctccgtggtc
ctccaggctgaagagatctcggagctgctgctagaatcatccacgtctgcacttgccaag
gactcgattgatttcctctctcttgatttgtcttatgaatgccaaagtgagacgagtcta
ccagagaagctgagtaaattgcagaccattgagccaaaagtgaaagttttcatcttcact
ctgagactccaggactgcccctcctccaggaagagtccagccagcctgctcttcagcttt
attgaagccataaataaagaccaaatgctcactcttgggtttgatgttaatgtgtttctg
agatgttcatcaacttccaagaaaagcatatcttgctttctgactgacagcctggccctt
cagacagaccacgagagagctgccaggaactcagcccctgcgtcggcctaccagagagtc
tgggaaatgtttgctcaccagcccagggcagaaagggatgcattcctgcaggatgctttt
ccccaaggcttcctgtggggcgtctccacgggagcctttaacgtggaaggaggctgggct
gagggcggaagaggacccagtgtctgggatcagtttgggcatctaaaagctgcccagggc
caggcgacaccggaggtggccagtgacagctactacaagtgggcctctgacgtggccctg
cttcgcggcctcagggctcaggtgtacaagttctccatctcctggtcccggatcttcccc
atggggcgcgggagcagccctagcccccagggcgtcgcctactataacaagctgatcgac
agcctgctggactcccacattgagcccatggccacgcttttccactgggacctgcctcag
gccctacaggatgagggagggtggcagaatgagagcgtggtggatgcctttgtggactac
gcagccttctgcttctctgcgttcgggaaccgtgtgaagctgtgggtgaccttccacgag
ccatgggtgatgagctacgcgggttatggcaccggccagcacgcaccaggcatctcagac
ccagggatcgcctcatttcaggtggctcacttggtcctcaaggcccacgccaggacttgg
caccactacaacagccaccatcgcccacagcagcagggccgtgtgggcattgtgctgaac
tcagactgggcagaacccctgtctccagagcgacctgaggaccttgcagcctctgagcgc
ttcttgcacttcatgctgggctggtttgcacaccccatctttgtggatggggactacccg
gccaccatgaaggctcagatccagcaaaggaatgaacagtgccctagtcctgtcgcacag
ctcccggagttcaccgacacagagaagcagctcttaaaaggctctgctgattttctgggt
ttgtctcattacacgtcgcgcctcatcagcaaggccccagaagacagctgcatccccagc
tatgataccatcggaggcttctcccaacacacggaccctgcatggccccagacttcgtct
ccttggattcgtgtggtgccctggggtataaggagactgttgcagtttgtatccttggaa
tacacaaaaggaaaagttccaatctacctggctgggaatggcatgcccataggggagagt
gaaaatctcctcaatgattccttgagagtagactacttcaatcagtacatcaatgaggtg
ctcaaggctatcagggaggactccgtggatgttcgttcttacattgctcgctccctcatg
gatggctttgaaggccccgcaggctacagccagagattcgggctataccatgtcaatttc
aacgagagcagcaagcccagaactcctaggaaatctgccttccttctcaccagcatcatt
gaaaagaatggtttcctcaccaaggcagtaaaacaaccgctaccacctaactcagcacac
ctgccttccaaaaccagagcctcggccctcccatcagaggtgccctccaaggctaaagtg
gtttgggagaagttctccaaccagaccaagtttgaaagagacttgttctatcacggtaca
ttccgggatgacttcctgtggggcgtgtcctcttcagcgtatcagattgaaggagcttgg
gatgctgatggcaaagggcccagcatttgggataactttactcacaccccagggaacggt
gtgacagacagctccacaggagacatcgcctgtgacagctacaaccaactggatgctgat
ctgaatgtgcttcgagctttgaaggtgaaagcctatcggttctccctctcctggtctcgc
attttcccaaccgggacaaacagctctatcaatagtcacggtgttgattattacaacagg
ctgatcgatggcttgctggcaagcgatatctttcccatggtgacactgtttcactgggac
ctgccccaggccctccaggatataggaggctgggagaatccttccttgattgatctgttt
gacagctatgcagactattgtttccagacgtttggggacagagtcaagttctggatcacc
cttaatgagcccacgtattattcatggtggagttacggctcagggacctttcccccaaat
gtgaatgacccaggctgggcaccttataggatcagccatgccctcatcaaagcgcatgcc
cgagtctaccacacgtatgatgagaaatacaggcagagtcagaacggggtcatctcattg
agtcttgtcgcacaatgggcagagcccaagtcaccggatgtccttagagacgtggaagca
gctgacagaaagatgcagttcaccctgggctggtacgcccaccccatttttaaaactgga
gactatcccgatgccatgaagtggaaagtgggcaacaggagtgaactccagcacttagcc
acatcccgcctgccaagcttcactgaggaagagaagagctacattaggggtacggccgac
gtcttctgcctcaacacctattcctccaaaattgtgcagcataagacacccgcgctcaac
ccaccctcctacgaagatgaccaggaattggctgaggaggaggatacctcatggccgacc
acggcaatgaacagagctgcgtcctttggaatgcggagactcctgaattggatcaaggaa
gaatatggagacatccccatttacatcacagaaaacggggtaggcttgacaaatccaaga
ctggaggatattgacaggatattttactacaaaacctacatcaacgaagctttgaaagcc
tacaggctcgatggtgtcaaccttcgaggatattttgcctggtctctgatggacaacttt
gagtggcttcgaggctacacagtcaagtttggactgtatcatgttgactttgaggatgtg
aacaggcctcgcacagcaagaatctcagccggttactacacagaacttattaccaacaac
ggcatgccactgcccagtgaggatgagttcatgtatggacagtttccagagggcttcatc
tggagtgcggctacttctgcctatcagattgaaggtgcatggagagcagatggcaaaagc
cttagtatttgggacacgtttactcacacacggctgaggattgagaacgatgacatcgca
gatgtggcctgtgacagttaccacaagatctctgaggacgtggtcgccctgcagaacctg
gccgtaacccactaccgcttttccatctcctggtctcgcatcctccctgacggaaccacc
aactacatcaacgaagcaggcctgaactactacgtgcggctcattgatgcgcttctggct
gccaacatcaagccccaggtgaccctgtaccactgggacctgccccaggcgctccaggat
gttggaggctgggagaatgagaccattgtgcagaggttcaaggagtatgcagatgtcctg
ttccagaggctgggagacaaagtgaagttttggatcacactgaatgagccttatgtcatt
gccaaccagggctatggctacggagtatcagccccagggatctcctttaggcctggcact
gctccctacattgttggccacaacttaataaaggctcacgctgaggcctggcatctgtac
aatgacgtgtaccgggccagccaaggaggtgtgatttccatcaccatcagcagtgactgg
gctgagcccagagacccctccaaccaagaggacgtggaggcagccaacagatatgttcag
tttctgggaggctggtttgcacaccccattttcaagaacggggactacaacgaggtgatg
aagacgcgaatccgtgagaggagcttggctgcggggcgcaacgtgtctcggctcccagag
ttcacagagagtgagaagaggaggatcaatggcacctatgacttttttgggttcaatcac
tacaccactgtcctggcctacaacctcaactaccccatcatctcctcctatgatgcagac
aggggagttgcctccatcgtagatcgctcttggccagactctggctctttctggctgaag
atgacaccttttggcttcaggaggatcctgaactggataaaggaggagtacaacaaccct
ccaatttatgtaacagagaacggggtgtcccatcggggagactcatacctcaatgacact
accaggatctactacctccgcagttacatcaacgaggccctcaaagctgtacagcaggac
aaggtggaccttcgaggatacacagtctggactctgatggacaacttcgagtgggccact
ggcttctcagataagtttggtctgcattttgtgaactacagtgacccttctctgccaagg
attcccagagagtctgccaagttttatgcctccatagtccggtgcaacggcttccccgac
cctgcagaaggacctcacccttgtctcctccagccagaagacactgaccccaccatgagc
cccgtgagccaggaggaagtccagttcctggggctgtcgctcggctcgacggaagcagag
acggctttgtacgtgctcttttctctcatgctgcttggagtctgtggcttggcgttttta
tcatacgcattgtgcaagagctccaagcaaaggaaaaaactaagccaacaggaactgagc
cccgtttcttcattctga

DBGET integrated database retrieval system