KEGG   Oryctolagus cuniculus (rabbit): 100352863
Entry
100352863         CDS       T03373                                 

Gene name
CDK1
Definition
(RefSeq) cyclin dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04115  p53 signaling pathway
ocu04218  Cellular senescence
ocu04540  Gap junction
ocu04914  Progesterone-mediated oocyte maturation
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100352863 (CDK1)
   04114 Oocyte meiosis
    100352863 (CDK1)
   04115 p53 signaling pathway
    100352863 (CDK1)
   04218 Cellular senescence
    100352863 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100352863 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100352863 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100352863 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100352863 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100352863 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100352863 (CDK1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100352863 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352863 (CDK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100352863 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100352863 (CDK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100352863 (CDK1)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100352863 (CDK1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100352863 (CDK1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100352863 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 100352863
NCBI-ProteinID: XP_002718519
Ensembl: ENSOCUG00000002858
UniProt: G1SIH0
LinkDB
Position
18
AA seq 297 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALNHPYFNDLDNQIKKI
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaggattataccaaaatcgagaaaattggagaaggtacctatggagttgtatataag
ggtagacacaaaactacaggccaagtggtagctatgaagaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaagaacttcgtcat
ccaaatatagtcagtcttcaagatgtgcttatgcaagattccaggttatatctcatcttt
gaattcctttccatggatctcaagaagtacttggattcaatccctcctggtcagttcatg
gattcttcgcttgttaagagttatttataccagatcctacaggggattgtgttttgtcac
tctagaagagttcttcatagagatttaaaacctcaaaatctattgattgatgacaaagga
accattaaactggctgattttggccttgccagagcttttggaatacctattagagtgtat
acacatgaggtagtaacactctggtatagatctccagaagtattgctggggtcagctcgt
tactctactccagttgacatttggagtataggcaccatatttgcagaattagcaactaag
aaaccacttttccatggagattcagaaattgatcagctcttcaggattttcagagccttg
ggcacgcccaataacgaagtgtggccagaagtggaatccttacaggactataagaataca
tttcctaagtggaaaccaggaagcttggcatctcatgtcaaaaatttggatgaaaatggc
ttggatttgctctcgaaaatgttagtctatgatcctgccaaacggatttctggcaaaatg
gcactaaatcatccatattttaatgatttggacaatcagattaagaagatatag

DBGET integrated database retrieval system