KEGG   Oryctolagus cuniculus (rabbit): 100352938Help
Entry
100352938         CDS       T03373                                 

Gene name
PARK7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    100352938 (PARK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ocu01002]
    100352938 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352938 (PARK7)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     100352938 (PARK7)
Peptidases [BR:ocu01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   100352938 (PARK7)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100352938 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 100352938
NCBI-ProteinID: XP_002716191
Ensembl: ENSOCUG00000016511
UniProt: G1TBS1
LinkDB All DBs
Position
13
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGSHYSYSESRVERDGLILTSRGPGTSFEFALAIVEALSGKEVADQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaaagagctctggtcatcctggccaaaggagccgaggagatggagacggtc
atccctgtggacgtcatgaggcgagctgggattaaggtcactgttgccggtctggctggg
aaggaccctgtacagtgtagccgtgacgttgtcatttgtcctgatgccagtctggaagat
gcaaaaaaagagggcccgtatgatgtggtcgtcctgccgggaggtaacctgggtgcacag
aatttgtctgagtctgcggccgtgaaggagatcctgaaggaacaagaaaagaggaagggc
ctcatagcggccatctgcgcaggtcccacggctctgctggctcatgagataggttttgga
agcaaagtcaccacacacccacttgctaaagacaaaatgatgaatgggagtcattacagc
tactccgagagccgcgtggagcgggatggcctgattctcaccagccgcggtccggggacc
agcttcgagttcgctctggccatcgtcgaggcgctgagtggcaaggaggtggcggatcaa
gtgaaggctcccctcgtgcttaaagattag

DBGET integrated database retrieval system