KEGG   Oryctolagus cuniculus (rabbit): 100353284
Entry
100353284         CDS       T03373                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100353284 (GADD45A)
   04064 NF-kappa B signaling pathway
    100353284 (GADD45A)
   04068 FoxO signaling pathway
    100353284 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100353284 (GADD45A)
   04210 Apoptosis
    100353284 (GADD45A)
   04115 p53 signaling pathway
    100353284 (GADD45A)
   04218 Cellular senescence
    100353284 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353284 (GADD45A)
   05202 Transcriptional misregulation in cancer
    100353284 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100353284 (GADD45A)
   05212 Pancreatic cancer
    100353284 (GADD45A)
   05225 Hepatocellular carcinoma
    100353284 (GADD45A)
   05226 Gastric cancer
    100353284 (GADD45A)
   05214 Glioma
    100353284 (GADD45A)
   05216 Thyroid cancer
    100353284 (GADD45A)
   05220 Chronic myeloid leukemia
    100353284 (GADD45A)
   05217 Basal cell carcinoma
    100353284 (GADD45A)
   05218 Melanoma
    100353284 (GADD45A)
   05213 Endometrial cancer
    100353284 (GADD45A)
   05224 Breast cancer
    100353284 (GADD45A)
   05222 Small cell lung cancer
    100353284 (GADD45A)
   05223 Non-small cell lung cancer
    100353284 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100353284 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100353284 (GADD45A)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100353284 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100353284 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100353284
NCBI-ProteinID: XP_002715979
Ensembl: ENSOCUG00000008954
UniProt: G1SW81
LinkDB
Position
13
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAKLLLLETDASPAASEGAAQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggacaaggtgggg
gatgccctggaggaggtgctgagcaaagccctgagtcagcgcaccatcaccgtcggtgtg
tacgaggcggccaagctgctcaacgtggacccggataacgtggtgctgtgcctgctggcg
gcggacgaggacgacgacagggatgtggcgctgcagatccacttcaccctgatccaggcg
ttctgttgcgagaacgacattaacatcctgcgcgtcagcaacccgggccggctggcgaag
ctcctgctcctggagaccgacgccagcccggcggccagcgagggcgccgcgcaaccgccg
gacctgcactgcgtgctggtgacgaatccacattcatcgcaatggaaggatcctgcctta
agccaacttatttgtttctgccgggaaagtcgctacatggatcagtgggtcccagtgatt
aatcttcctgaacggtga

KEGG   Oryctolagus cuniculus (rabbit): 100353742
Entry
100353742         CDS       T03373                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100353742 (GADD45G)
   04064 NF-kappa B signaling pathway
    100353742 (GADD45G)
   04068 FoxO signaling pathway
    100353742 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100353742 (GADD45G)
   04210 Apoptosis
    100353742 (GADD45G)
   04115 p53 signaling pathway
    100353742 (GADD45G)
   04218 Cellular senescence
    100353742 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353742 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100353742 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100353742 (GADD45G)
   05212 Pancreatic cancer
    100353742 (GADD45G)
   05225 Hepatocellular carcinoma
    100353742 (GADD45G)
   05226 Gastric cancer
    100353742 (GADD45G)
   05214 Glioma
    100353742 (GADD45G)
   05216 Thyroid cancer
    100353742 (GADD45G)
   05220 Chronic myeloid leukemia
    100353742 (GADD45G)
   05217 Basal cell carcinoma
    100353742 (GADD45G)
   05218 Melanoma
    100353742 (GADD45G)
   05213 Endometrial cancer
    100353742 (GADD45G)
   05224 Breast cancer
    100353742 (GADD45G)
   05222 Small cell lung cancer
    100353742 (GADD45G)
   05223 Non-small cell lung cancer
    100353742 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100353742 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100353742 (GADD45G)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100353742 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100353742 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100353742
NCBI-ProteinID: XP_002708333
Ensembl: ENSOCUG00000013296
LinkDB
Position
1
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENAIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacggttccggaaagcacagccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtcggcgcagcgccagggctgtctcacc
gccggcgtctacgagtccgccaaagtcctgaacgtggaccccgacaatgtgaccttctgc
gtgctggccgccgacgaggaggacgagggcgacatcgcgctgcagatccacttcacgctg
atccaggcgttctgctgcgagaacgccatcgatatcgtgcgcgtgggcgacgtgcagcgg
ctggccgcgatcgtgggtgccggcgaggaggcgggcgcgccgggcgacctgcactgcatt
ctcatctcgaaccccaatgaggacgcgtggaaagaccctgccttggagaaactcagcctg
ttctgcgaggagagccgcagcgtcaacgactgggtgcccagcataaccctccccgagtga

DBGET integrated database retrieval system