KEGG   Oryctolagus cuniculus (rabbit): 100353390
Entry
100353390         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353390
   04151 PI3K-Akt signaling pathway
    100353390
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353390
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100353390
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100353390
   04621 NOD-like receptor signaling pathway
    100353390
   04622 RIG-I-like receptor signaling pathway
    100353390
   04623 Cytosolic DNA-sensing pathway
    100353390
   04650 Natural killer cell mediated cytotoxicity
    100353390
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353390
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100353390
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100353390
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100353390
   05162 Measles
    100353390
   05164 Influenza A
    100353390
   05161 Hepatitis B
    100353390
   05160 Hepatitis C
    100353390
   05168 Herpes simplex virus 1 infection
    100353390
   05163 Human cytomegalovirus infection
    100353390
   05167 Kaposi sarcoma-associated herpesvirus infection
    100353390
   05169 Epstein-Barr virus infection
    100353390
   05165 Human papillomavirus infection
    100353390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353390
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353390
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100353390
NCBI-ProteinID: XP_002708102
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcagaggaaatgcctctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100354654
Entry
100354654         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354654
   04151 PI3K-Akt signaling pathway
    100354654
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354654
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100354654
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100354654
   04621 NOD-like receptor signaling pathway
    100354654
   04622 RIG-I-like receptor signaling pathway
    100354654
   04623 Cytosolic DNA-sensing pathway
    100354654
   04650 Natural killer cell mediated cytotoxicity
    100354654
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354654
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100354654
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100354654
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100354654
   05162 Measles
    100354654
   05164 Influenza A
    100354654
   05161 Hepatitis B
    100354654
   05160 Hepatitis C
    100354654
   05168 Herpes simplex virus 1 infection
    100354654
   05163 Human cytomegalovirus infection
    100354654
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354654
   05169 Epstein-Barr virus infection
    100354654
   05165 Human papillomavirus infection
    100354654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354654
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100354654
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100354654
NCBI-ProteinID: XP_002708106
Ensembl: ENSOCUG00000027561
UniProt: G1TKA0
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLNDRRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKKYSPCAWEVVRAEARRAVSLSRI
WQERLWRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcaatgacaggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctttcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
catgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactctgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagattatggcgcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100355669
Entry
100355669         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355669
   04151 PI3K-Akt signaling pathway
    100355669
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355669
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100355669
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100355669
   04621 NOD-like receptor signaling pathway
    100355669
   04622 RIG-I-like receptor signaling pathway
    100355669
   04623 Cytosolic DNA-sensing pathway
    100355669
   04650 Natural killer cell mediated cytotoxicity
    100355669
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355669
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100355669
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100355669
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355669
   05162 Measles
    100355669
   05164 Influenza A
    100355669
   05161 Hepatitis B
    100355669
   05160 Hepatitis C
    100355669
   05168 Herpes simplex virus 1 infection
    100355669
   05163 Human cytomegalovirus infection
    100355669
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355669
   05169 Epstein-Barr virus infection
    100355669
   05165 Human papillomavirus infection
    100355669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355669
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355669
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100355669
NCBI-ProteinID: XP_002708110
Ensembl: ENSOCUG00000022979
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLACLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEETPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctcttgcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagacacccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcggaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100355912
Entry
100355912         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355912
   04151 PI3K-Akt signaling pathway
    100355912
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355912
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100355912
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100355912
   04621 NOD-like receptor signaling pathway
    100355912
   04622 RIG-I-like receptor signaling pathway
    100355912
   04623 Cytosolic DNA-sensing pathway
    100355912
   04650 Natural killer cell mediated cytotoxicity
    100355912
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355912
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100355912
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100355912
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355912
   05162 Measles
    100355912
   05164 Influenza A
    100355912
   05161 Hepatitis B
    100355912
   05160 Hepatitis C
    100355912
   05168 Herpes simplex virus 1 infection
    100355912
   05163 Human cytomegalovirus infection
    100355912
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355912
   05169 Epstein-Barr virus infection
    100355912
   05165 Human papillomavirus infection
    100355912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355912
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355912
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100355912
NCBI-ProteinID: XP_002708111
Ensembl: ENSOCUG00000021123
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDRRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
LQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacaggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
ttgcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356419
Entry
100356419         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-14-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356419
   04151 PI3K-Akt signaling pathway
    100356419
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356419
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356419
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100356419
   04621 NOD-like receptor signaling pathway
    100356419
   04622 RIG-I-like receptor signaling pathway
    100356419
   04623 Cytosolic DNA-sensing pathway
    100356419
   04650 Natural killer cell mediated cytotoxicity
    100356419
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356419
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100356419
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356419
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356419
   05162 Measles
    100356419
   05164 Influenza A
    100356419
   05161 Hepatitis B
    100356419
   05160 Hepatitis C
    100356419
   05168 Herpes simplex virus 1 infection
    100356419
   05163 Human cytomegalovirus infection
    100356419
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356419
   05169 Epstein-Barr virus infection
    100356419
   05165 Human papillomavirus infection
    100356419
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356419
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356419
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100356419
NCBI-ProteinID: XP_002708112
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLLQTHSLNDGRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
LQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcttcagacccacagcctcaatgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
ttgcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356678
Entry
100356678         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356678
   04151 PI3K-Akt signaling pathway
    100356678
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356678
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356678
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100356678
   04621 NOD-like receptor signaling pathway
    100356678
   04622 RIG-I-like receptor signaling pathway
    100356678
   04623 Cytosolic DNA-sensing pathway
    100356678
   04650 Natural killer cell mediated cytotoxicity
    100356678
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356678
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100356678
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356678
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356678
   05162 Measles
    100356678
   05164 Influenza A
    100356678
   05161 Hepatitis B
    100356678
   05160 Hepatitis C
    100356678
   05168 Herpes simplex virus 1 infection
    100356678
   05163 Human cytomegalovirus infection
    100356678
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356678
   05169 Epstein-Barr virus infection
    100356678
   05165 Human papillomavirus infection
    100356678
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356678
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356678
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100356678
NCBI-ProteinID: XP_002708113
LinkDB
Position
1
AA seq 189 aa
MASAFCLVLVLVVFNCMSVCALNCDLPQTHSQNNKETFKKLREMRKVMGFFCMQYIHDFG
LPREELEGHQVQKAQTIAVLHEVTQGVFTLFCAPDSSATWNNTILDILCSRLHQQLSDLE
ACVKQEVEVKQTPTIQNPSVRAVNKYFRNIRLYLTEKEDSPCAWMTVTLEVSRAMSLSRF
LQERLRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcggcattttgtcttgtgctggtgctggtagtattcaactgtatgtctgtctgt
gctctgaattgtgatctacctcagactcacagccagaataacaaagaaactttcaagaag
ctgagagaaatgaggaaagtgatgggcttcttctgcatgcagtacattcacgattttggg
ttaccacgggaggagcttgaaggacaccaggtccagaaggctcaaactattgctgtgctg
catgaggtgacccagggggtcttcacacttttctgcgcaccggactcatctgctacctgg
aacaataccatcctggacatactgtgctctagactccaccagcagctgagtgacctggaa
gcctgtgtgaagcaagaagtggaggtgaaacagacacccacgatacagaatccctctgta
cgagctgtgaataagtacttcagaaatatccgcctctatctgacagagaaggaagacagc
ccttgtgcctggatgactgtcacactagaagtttcgagagccatgtctttatcaagattc
ttgcaagaaagattaagaagtaaggattga

KEGG   Oryctolagus cuniculus (rabbit): 100357194
Entry
100357194         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357194
   04151 PI3K-Akt signaling pathway
    100357194
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357194
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100357194
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100357194
   04621 NOD-like receptor signaling pathway
    100357194
   04622 RIG-I-like receptor signaling pathway
    100357194
   04623 Cytosolic DNA-sensing pathway
    100357194
   04650 Natural killer cell mediated cytotoxicity
    100357194
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357194
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100357194
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100357194
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357194
   05162 Measles
    100357194
   05164 Influenza A
    100357194
   05161 Hepatitis B
    100357194
   05160 Hepatitis C
    100357194
   05168 Herpes simplex virus 1 infection
    100357194
   05163 Human cytomegalovirus infection
    100357194
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357194
   05169 Epstein-Barr virus infection
    100357194
   05165 Human papillomavirus infection
    100357194
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357194
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357194
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100357194
NCBI-ProteinID: XP_002708115
Ensembl: ENSOCUG00000022525
UniProt: G1TMS3
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcctttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100357708
Entry
100357708         CDS       T03373                                 

Definition
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357708
   04151 PI3K-Akt signaling pathway
    100357708
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357708
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100357708
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100357708
   04621 NOD-like receptor signaling pathway
    100357708
   04622 RIG-I-like receptor signaling pathway
    100357708
   04623 Cytosolic DNA-sensing pathway
    100357708
   04650 Natural killer cell mediated cytotoxicity
    100357708
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357708
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100357708
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100357708
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357708
   05162 Measles
    100357708
   05164 Influenza A
    100357708
   05161 Hepatitis B
    100357708
   05160 Hepatitis C
    100357708
   05168 Herpes simplex virus 1 infection
    100357708
   05163 Human cytomegalovirus infection
    100357708
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357708
   05169 Epstein-Barr virus infection
    100357708
   05165 Human papillomavirus infection
    100357708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357708
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357708
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100357708
NCBI-ProteinID: XP_002708117
Ensembl: ENSOCUG00000020925
UniProt: G1SHR2
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcctctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

DBGET integrated database retrieval system