KEGG   Oryctolagus cuniculus (rabbit): 100353929Help
Entry
100353929         CDS       T03373                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00604  Glycosphingolipid biosynthesis - ganglio series
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100353929 (B3GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ocu01003]
    100353929 (B3GALT4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     100353929 (B3GALT4)
Glycosyltransferases [BR:ocu01003]
 Glycan extension
  Glycolipid
   100353929 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 100353929
NCBI-ProteinID: XP_002714663
Ensembl: ENSOCUG00000010550
UniProt: G1TYQ2
LinkDB All DBs
Position
12
AA seq 383 aa AA seqDB search
MPLSPFRRLLLAALLLVIVWTLFGPSGIGEELLSLSLASWLPAPSSPGPPLALPRLLIPN
REACGGPGAPPFLLILVCTAPENLQQRNAIRASWGGLREARGLRVQTLFLLGEPNWPQPA
WGSHGHDLAWESATQRDILQAAFQDSYRNLTLKTLSGLNWADKHCPLARYILKTDDDVYV
NVPELVSELVLRGGRWEQWERVEESQRKAAHEDKTWEGSLALGAKATPLLYLGRVHWRVN
PSRLPGGRHHVSEKQWPHTLGPFPPYASGTGYVLSASAVQLVLRVASQAPPLPLEDVFVG
VSARRGGLAPTHCVRLAGATHYPLDRCCYGKFLLTSHKLDPWEMQEAWKLVGGSDGERIA
PFCSWLQGTLGILRCRVMAWLHS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcagccccttccggcgcctcctcctcgccgctttgctgctggtgatcgtctgg
accctctttgggccttcgggcatcggggaggagctgctgagcctctccctggcctcctgg
ctcccagccccttcctcgcccggcccgcccctggccctgccccgcctcttgatacccaac
cgggaggcctgcggtggtcccggagctcccccgttcctgctaatcctggtgtgcacagcc
ccggagaacctgcagcagagaaatgccatccgggcctcgtggggcgggctgcgtgaggcc
cgggggctcagggtgcagacgctcttcctgctgggagaacccaattggccacaaccagcg
tggggctctcacgggcacgacctggcgtgggagtcagccacacagcgggatatcctacag
gcagccttccaggactcctaccgaaacctcaccctcaagaccctcagtgggcttaattgg
gccgacaaacactgccccttggcccgctacatcctcaaaacagacgatgatgtgtatgtc
aatgtcccggaactggtatccgaactggttctgcgagggggccgttgggagcaatgggag
agggttgaggagtcccagaggaaggctgcacatgaagacaaaacgtgggagggcagcctg
gctctgggtgccaaggccacacctctcctgtacctaggccgggtgcactggagggtgaat
ccctctcggctgccagggggccgccaccacgtatcagagaagcagtggcctcacacgttg
ggcccctttccaccctatgcctcgggcacggggtacgtgctgtccgcttctgccgtgcag
ctcgttctgagggtggccagccaggcaccccctctcccgttggaggacgtctttgtgggg
gtaagtgctcgacgaggcggccttgccccaacccactgtgtcaggctggctggtgctacc
cactacccactggaccgctgctgctacggcaagttcctgctgacgtcccacaagctggac
ccctgggagatgcaggaagcctggaagctggtgggcggctctgatggggaaaggattgcg
cccttctgctcctggctccaggggaccctgggcatcctgcggtgtcgggtcatggcctgg
ctccacagctga

DBGET integrated database retrieval system