KEGG   Oryctolagus cuniculus (rabbit): 100354055
Entry
100354055         CDS       T03373                                 

Gene name
UPF2
Definition
(RefSeq) UPF2 regulator of nonsense transcripts homolog (yeast)
  KO
K14327  regulator of nonsense transcripts 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100354055 (UPF2)
   03015 mRNA surveillance pathway
    100354055 (UPF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100354055 (UPF2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     100354055 (UPF2)
   mRNA cycle factors
    P-body specific factors
     100354055 (UPF2)
SSDB
Motif
Pfam: MIF4G Upf2
Other DBs
NCBI-GeneID: 100354055
NCBI-ProteinID: XP_002717550
Ensembl: ENSOCUG00000006230
LinkDB
Position
16
AA seq 1287 aa
MPGPGLGAGGGEPAVAGLKIVLGHIMPAERKKPASMEEKESLLNNSEKDCSERRPVSSKE
KPKDDLKLTAKKEVSKVPEDKKKKLEEDKRKKEDKERKKKEEEKVKAEEEEKKKHEEEER
KKQEEQAKRQQEEEAAQLKEKEESLQLHQEAWERHQLRKELRSKNQNAPDNRPEENFFSR
LDSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAV
HLCSLFHQRYADFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEG
LSLIYEQLKNIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEI
ISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFA
MSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDED
ARNFYENLIDLKAFVPAILFKDNEKSCQNKDSNKEDSKEAKESKDNKEVSSPDDLELELE
NLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDL
IDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSM
LRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMA
CTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKT
VKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNS
IHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRM
VESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLD
CFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVHDL
EREFLIKLGLVNDKDSKDSMTEGENLEDDDEEEEGGAETEEQSGNESEVNEPEEEEGSDN
DDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLE
NLQQRSGESVKVHQLDVAIPLHLKSQLKKGPPLGGGEGEAESTDTMPFVMLTRKGNKQQF
KILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPAN
TNRERRPRYQHPKGAPNADLIFKTGGR
NT seq 3864 nt   +upstreamnt  +downstreamnt
atgcctgggccgggcctcggcgctggaggcggggagcctgccgtggccgggttgaagatt
gtcctgggtcacataatgccagctgagcgtaaaaagccagcaagtatggaagaaaaagaa
tctctactaaacaacagtgagaaagactgcagtgaaaggcggccagtgagcagcaaggag
aaaccaaaagacgatctcaagctcactgccaagaaggaggtcagtaaggtccctgaagac
aaaaagaagaagctggaagaagataagagaaaaaaggaagataaggaacgcaagaaaaaa
gaagaagaaaaggtaaaggcagaggaagaagaaaaaaagaaacatgaagaagaagagaga
aaaaagcaagaagagcaggcaaaacgacagcaagaagaagaagctgcccagttgaaagaa
aaagaagaatcccttcagcttcatcaggaagcttgggaacgacatcagttaagaaaggaa
cttcgtagcaaaaaccaaaatgctccagacaaccgaccagaggaaaacttctttagccgc
ctagactcaagtttgaagaaaaacactgcttttgtcaagaaactaaaaactattacagaa
caacagagagactccttgtcccatgattttaatggcctgaatttaagcaaatacattgca
gaagctgtagcttctattgtggaagcaaagttaaaaatctctgatgtgaactgtgctgtg
cacctttgctctctctttcaccagcgctatgctgactttgccccatctcttcttcaggtc
tggaaaaaacattttgaagcaaggaaagaggaaaaaactcctaacattaccaaattaaga
actgatttgcgtttcattgcggaattgacaatagttgggattttcacggacaaggagggt
ctttccttaatatatgaacagctaaaaaatattattaatgctgatcgggaatctcatact
catgtttccgtggtgattagtttctgtcgacattgtggagatgatattgctggactcgta
ccaaggaaagtaaagagtgctgcagaaaagtttaatttgagttttcctcctagtgagatc
attagtccagagaaacaacagcctttccagaatcttttaaaagagtactttacgtctttg
accaaacacctgaaaagggaccacagggagctccagaatactgagagacaaaacaggcgt
attcttcattctaaaggagagctaagtgaagacagacataaacagtatgaagaattcgct
atgtcttatcagaaactgctggcaaattcgcagtccttagcagatcttttggatgaaaat
atgccagatcttcctcaggacaaaccaacaccagaagagcatggacctggaattgatata
tttacacctggtaaacctggagaatatgacttggaaggtggtatatgggaagatgaagat
gctcggaatttttatgagaatctcattgatttgaaagcttttgttccagctatcttgttt
aaagacaatgaaaaaagttgtcaaaataaagattccaacaaagaggattccaaagaggca
aaagaatctaaggataataaggaggtctcaagtcctgatgatttggaacttgagttggag
aatctagaaattaatgatgacactttagaattagaaggtggagatgaagccgaggatctt
acaaagaaacttcttgatgaacaagaacaagaagatgaagaagccagcactgggtctcat
ctcaagctcatagtggatgctttcctgcagcaattgcccaattgtgtcaaccgagatttg
atagacaaggcagcaatggatttttgcatgaacatgaacacaaaagcaaacaggaagaag
ttggtacgggcactcttcatagttcctagacaaaggttggatttgctaccattttatgca
agattggttgctacattgcatccctgcatgtctgatgtagcagaggatctttgttccatg
ctgaggggggatttcagatttcatgtacgtaaaaaggaccagatcaatattgaaaccaag
aacaaaactgttcgttttattggagagttaaccaagtttaagatgttcacgaaaaatgac
acactacattgtttaaagatgcttctgtcagatttttctcatcaccatattgaaatggca
tgcacccttctggaaacatgtgggcgatttctgttcagatctccagaatcacacctgagg
accagtgtacttttggagcaaatgatgagaaagaaacaagccatgcatcttgatgcaaga
tacgtcacaatggtggagaatgcatactactactgcaacccacctccagctgaaaagacg
gtgaaaaagaaacgccctcctctccaggaatatgttcggaaacttttgtacaaagatctc
tctaaggttaccaccgagaaggttttgagacagatgcgaaaattgccctggcaggaccaa
gaagtgaaagattatgtcatctgttgtatgataaacatttggaatgtgaaatataacagt
attcactgtgtagccaacctcttggcaggactggtgctctaccaagaggatgttgggatc
cacgttgtggatggagtcttagaagatatccgattaggaatggaggttaatcagcctaaa
tttaatcagcggcgtatcagcagcgccaagttcttaggggaactttataattaccgaatg
gtggaatcagccgttattttcaggactctctattcttttacttcatttggtgttaaccct
gatggttctccaagttcgctggaccctcctgagcatcttttcagaattcgactcgtctgt
actattttggatacctgtggccagtactttgacagaggttccagtaaacgaaaacttgat
tgcttccttgtatattttcagcgttatgtttggtggaagaaaagtttggaggtttggaca
aaagaccatccatttcctattgatatagattatatgatcagtgatacactagaactccta
agaccaaagatcaaactctgtaattctctggaagaatccatcaggcaggtacatgacttg
gaacgagaattcttaataaaactaggcctagtaaatgacaaggattccaaagattctatg
acagaaggagaaaatcttgaagatgatgatgaagaagaagaaggaggtgccgaaacagaa
gaacagtctggaaatgaaagtgaagtaaatgagccagaagaagaggaaggttctgataat
gatgatgatgagggagaagaagaggaagaagagaatacagattaccttacagattccaat
aaggagaatgaaactgatgaagagaatactgaggtaatgattaaaggaggtggactgaag
cacgtgccttgtgtagaagatgaggactttattcaagctctggataaaatgatgctagaa
aatcttcagcaacgaagtggagaatctgttaaagtgcaccaacttgatgttgcaattcct
ttgcatctcaaaagccagctgaagaaaggtcccccacttggtggtggggaaggagaggca
gagtccacagacaccatgccatttgtcatgttaacaagaaaaggcaataaacagcagttt
aagattcttaatgtgcccatgtcttctcaacttgctgcaaatcattggaaccagcaacag
gcagaacaagaagagaggatgagaatgaaaaagcttacactagatatcaatgaacggcaa
gaacaagaagattatcaagaaatgttgcagtctcttgcacagcgcccagctccagcaaac
accaatcgtgagcggcggcctcgttaccaacatccaaagggagcacctaatgcagatcta
atctttaagactggtgggaggtaa

DBGET integrated database retrieval system