KEGG   Oryctolagus cuniculus (rabbit): 100354139
Entry
100354139         CDS       T03373                                 

Gene name
SETD1A
Definition
(RefSeq) SET domain containing 1A
  KO
K11422  [histone H3]-lysine4 N-trimethyltransferase SETD1 [EC:2.1.1.354]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00310  Lysine degradation
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100354139 (SETD1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100354139 (SETD1A)
Enzymes [BR:ocu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     100354139 (SETD1A)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100354139 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     100354139 (SETD1A)
    COMPASS/SET1 complex (yeast)
     100354139 (SETD1A)
SSDB
Motif
Pfam: N-SET SET RRM_1 Topoisom_I_N
Other DBs
NCBI-GeneID: 100354139
NCBI-ProteinID: XP_017193234
LinkDB
Position
Un
AA seq 1631 aa
MDQDGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKTRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGPGAAAETTESRRRSSSDAAAYPAGTAVVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSASFKSRR
AENSYQDSFSRRHFSASSVPTTASPAISATTAATATPSSSSSSLSSSSASSSSSSSSQFR
GSDSNYPAYYESWNRYQRHSSYPPRRGAREEPPGPPFAENTAERFPPSYTSYLPPEPSRP
ADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEGEEARTSPRPASPARSGSPAPETTNESV
PFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSAGPERDPGSEVPSGSGHGPCTPP
PAPANFEDVAPAGAGDPGAPRESPKANGQNQPHIYDFVNSLELMDRLGAQWGGMPMSFQM
QTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLPFPPHQEAAYGLPYTLYTQGQEGRGA
YSRDPYHLPLPMTAEPLPSSVSGAEARLPPREEAELAEGKALQSAGTVGRVLATLVQEMK
SIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSL
VDWAKSGGATGIEAFAFGSGLRGALRLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDED
DPEREKEAGEPGRAGTKPPKREEERGKTQGKHRKSFALDSEGEEASQESSSEKDEEDEEE
DEEDEEREEAMDTAKKETEVSDGEDEESDSSSKCSLYADSDGENGSTSDSESSSSSSSSS
TSSSSSSSSSSSSSSESSEEEEEEEEEEHPPTIPSASSPPRDVPAPLPVPAVEPAPEGVA
ASAVTPAPEQEGSPARPAGPTEQPSPIVPQPLPEPPAGPPASTLRPDERPSSPIPLLPPP
KKRRKTVSFSAVEEVPAPEPPPAAPPQARSPGPVARKVPRGLERTIRNLPLDHASLVKSW
PEEVSRGGRNRAGGRGRSTEEEEAEPGTEVDLAVLADLALTPARRGLAALPPGDDSEATE
TSDEADRPSPMLSHVLLEHNYALAVKPAPSTPAPRPPEPVPAPAALFSSPVDEVLEAPEV
VVAEAEEPKQQQQQVQQPPEEAGEEEEEDEEEEEESSESSSSSSSDGEGAVRRRSLRSHT
RRRRPPLLPPPPPPPPPSFEPRSECEQMTILYDIWNSGLDLEDMRYLRLTYEQLLQQTSG
ADWLNDTHWVQHTITNLNTPKRKRRPQDGPREHQTGSARSEGYYPISKKEKDKYLDVCPV
SARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIVDSDLLKLNQLKFRKKKLRFGRSR
IHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDAT
KCGNLARFINHCCTPNCYAKVITIEAQKKIVIYSKQPIGVDEEITYDYKFPLEDTKIPCL
CGTDSCRGSLN
NT seq 4896 nt   +upstreamnt  +downstreamnt
atggatcaggacggtgggggagatgggcagaaagccccgagctttcagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccttgcgcaggccttcgcaaaaggtgtac
cgctacgacggcgtccacttcagcgtcaacgactccaagtacatacccgtggaagacctt
caagacccccgatgtcacgtcaggtccaaaacccgagacttctccctcccggtgcccaag
tttaagctggatgagttctacatcgggcagatccccctgaaggaggtgactttcgccagg
ctgaacgacaacgtgcgggagaccttcctgaaggacatgtgccgcaagtatggcgaggtg
gaggaggtggagatcctcctgcacccccgcacccgcaagcacctgggcctggcccgcgtg
ctcttcaccagcacgcgcggcgccaaggagacggtgaagaacctgcacctcacctccgtc
atgggcaacatcatccacgcccagctcgacatcaaaggacagcagcgaatgaaatactat
gaactgattgtcaatggctcctacacccctcagactgtgcccaccgggggcaaggccctg
agcgagaagttccagggccctggtgcagccgccgagacgaccgagtcccgccgccgctca
tcctcggacgcagccgcatacccggcgggcactgcggtggtgggcacccctggcaatggc
accccctgctcccaggacacaagcttctccagcagtcgacaggacaccccttcttccttc
ggccagttcaccccccagtcctcccaaggcaccccgtacacctcccggggcagcaccccc
tactctcaggattccgcctactccagcagcaccacttcagcctccttcaagtcccggcgg
gcggagaacagctaccaggattccttctcccgccgccacttctctgcctcgtcggtcccc
accaccgcctccccggccatctcggccaccaccgcggccaccgccactccctcctcctcc
tcctcgtcgttgtcctcgtcctcggcgtcgtcgtcctcttcgtcgtcctctcagttccgc
ggttccgactccaactacccagcgtattacgaaagctggaatcgctatcagcgacacagt
tcctaccccccacgccggggggcccgggaggagcccccggggcccccattcgctgaaaac
acagcagagcgcttccccccttcctacacctcctacttgccccccgagcccagccggccc
gccgaccaggactaccggcccccggcctccgaggccccacccccagagcctccagaacct
ggcggaggtgggggcggcgggggacccagccccgaaggtgaagaagctcggacttcccct
cgcccggcctccccggcccgctccggctccccggccccggagaccacgaacgagagcgtg
cccttcgcgcagcacagcagcctggactcccgcatcgagatgctgctgaaggagcagcgc
tccaagttctctttcctggcctccgacacggaggaggaggaagagaacagcgcggggcct
gagcgagacccgggcagtgaggtgccttccgggtcgggccacgggccctgcacaccccct
ccggccccggctaactttgaggacgtggcacctgcaggggccggggaccctggggctccc
cgggagtctcccaaggccaacggacaaaaccagccccacatctatgactttgtcaactcc
ctggagctcatggatcgactcggggctcagtggggagggatgcccatgtccttccagatg
cagacccagatgctgactcggctccaccagctgcggcagggcaaggggctgactgccgcc
tcggctggtccccctggaggggcctttggggaggccttcctcccgttcccaccccaccaa
gaggcagcctacggcttgccctacacgctctatacacaaggccaggaaggccgtggggcg
tactcacgggatccctaccacctgcctttgcccatgacagccgagcccctgccctcctcg
gtctcgggagcagaggcccggctgcctcccagggaggaagccgagctggcggagggcaag
gccctgcagtcggcgggcaccgtggggcgcgtgctggccaccctggtccaggagatgaag
agcatcatgcagcgagatctcaaccgcaagatggtggagaatgtggccttcggggccttc
gaccagtggtgggagagcaaggaagagaaggccaagcccttccagaacgcggccaaacag
caagccaaggaggaggataaagagaagacgaagctcaaagagccgggcctgctgtcactc
gtggactgggccaagagcgggggagccacgggcattgaggccttcgccttcggctcgggg
ctgcgcggggccctgcggctgccttcgttcaaggtgaagcggaaagaaccatccgaaatt
tccgaggccagtgaggaaaagcggcctcggccctccactccggctgaggaggatgaagat
gatcctgagcgggagaaggaagctggagagccaggacgtgcggggaccaagcccccaaag
cgagaggaagaacgcggcaagacccagggcaagcatcgcaagtcctttgcgctggacagc
gaaggggaggaggcgtcccaggagtcctcctcggagaaggatgaggaggacgaggaggaa
gacgaagaagacgaagagcgagaggaagctatggataccgctaagaaggagacagaggtg
tcagatggcgaggacgaggaaagcgattcgtcctccaaatgttctctgtatgccgactca
gatggtgaaaatggtagcacgtcggactcggagagcagcagttcctccagctcctcctcc
acctcgtcgtcgtcctcgtcttcctcgtcgtcgtcttcgtcatctgagtcctctgaggaa
gaggaggaggaagaggaagaggagcaccccccgaccatcccctcagcctcgtcgcctccc
agagacgtcccagcgcccctgccagtgcctgcggttgagcccgcgccggagggcgttgca
gcctctgctgtcacacctgcccccgagcaggaggggtccccagcgcggcctgcaggtccc
actgagcagccatctcccatcgtgccccagcctctcccggagccaccagccgggcccccg
gcctccaccctccgccccgacgagcgcccctcttctcctatcccgctcctgcccccaccc
aagaaacgccggaaaaccgtctccttctccgccgtggaggaggtgccagccccagagcct
cccccggctgccccgccgcaggccaggtctccgggcccagtcgctcgcaaagtgccccgg
ggcttggagcggaccattcgcaacctgcctctggaccacgcgtccctggtcaagagctgg
cccgaggaggtgtcccgagggggtcggaaccgggctggaggccgcggccgctccaccgag
gaagaggaggctgagccgggcacggaggtggacctggccgtgctggctgacctggccctg
accccagcccggcgcgggctggctgccctgcctcccggtgacgactcggaggccacagag
acctcggacgaggcagaccggcccagccccatgctcagccacgtgctcctggaacacaac
tacgccctagccgtcaagcccgcgccctccacgccggcccctcggcccccggagcccgtg
cccgcccctgcggccctcttcagctccccggtggacgaggtcctggaggcccccgaggtg
gtggtggcggaggccgaggagcccaagcagcagcagcagcaagtgcagcagccgccggag
gaggccggggaggaggaggaggaggacgaggaggaggaggaggagtcctcggagagcagc
agcagcagcagcagcgacggcgagggcgctgtccgccggcgcagcctccgctcccacacc
cgccgccggcggccgcccctcctgcccccgcccccgcccccgcccccaccctccttcgag
ccccgcagtgagtgtgagcagatgaccatcctgtatgacatttggaactcgggcctggac
ttggaggacatgaggtacctgcggctcacatacgagcagctgctgcagcagacgagcggg
gccgactggctcaacgacacccactgggtccagcacaccatcaccaatctgaacactcca
aaacgcaagcggcggccccaggacgggccccgggagcaccagacgggctcggcccgcagc
gaaggctactaccccatcagcaagaaggagaaagacaagtacctggacgtgtgccccgtc
tcggcccggcagctggaaggagtggacactcagggcactaaccgagtgctttctgagcgc
cggtccgagcagcggcggctgctcagcgccatcggcacctcagccatcgtggacagtgac
ctgctgaagctaaaccagctcaagttccggaagaagaagctgcggttcggccggagccgg
atccacgagtggggtctgtttgccatggaacccattgccgccgacgagatggtcatcgaa
tacgtgggccagaacatccggcagatggtggctgacatgcgggagaagcgctacgtgcag
gagggcatcggcagcagctacctgttccgcgtggaccacgacaccatcatcgacgccacc
aagtgcggcaacctggcgcgcttcatcaaccactgctgcacgcccaactgctacgccaag
gtgatcaccatcgaggcgcagaagaagatcgtcatctactcgaagcagcccatcggcgtg
gatgaggagatcacctacgactacaagttcccgctggaggacaccaagatcccgtgtctg
tgcggcaccgacagctgccggggctccctcaactga

DBGET integrated database retrieval system