KEGG   Oryctolagus cuniculus (rabbit): 100354287
Entry
100354287         CDS       T03373                                 

Gene name
RXRB, RXRbeta
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03320  PPAR signaling pathway
ocu04659  Th17 cell differentiation
ocu04919  Thyroid hormone signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05216  Thyroid cancer
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100354287 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100354287 (RXRB)
   03320 PPAR signaling pathway
    100354287 (RXRB)
   04919 Thyroid hormone signaling pathway
    100354287 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100354287 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354287 (RXRB)
   05202 Transcriptional misregulation in cancer
    100354287 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100354287 (RXRB)
   05216 Thyroid cancer
    100354287 (RXRB)
   05222 Small cell lung cancer
    100354287 (RXRB)
   05223 Non-small cell lung cancer
    100354287 (RXRB)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100354287 (RXRB)
Nuclear receptors [BR:ocu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100354287 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1 Ribosomal_60s
Other DBs
NCBI-GeneID: 100354287
NCBI-ProteinID: XP_002714529
Ensembl: ENSOCUG00000011590
LinkDB
Position
12
AA seq 537 aa
MSWAARPPFLPERHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAAAVAAG
EQQTPEPEPGEAGRDGMGDSGRDSRSPDSSSPAPLTQGLSPPSPPGPPLPASAAPSLGGS
GAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGAGPP
EDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKD
LTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAP
EEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKR
IPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAI
FDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCK
QKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgtcttgggccgctcgcccgcccttcctccccgagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatccggcggcggcggcggcggcggcggcggcggcggcagtagcagccgga
gaacaacaaaccccggagccggagccgggggaggctggacgggacgggatgggcgacagc
gggcgggactcccgaagcccagacagctcctccccagccccccttacacaggggctctcc
cccccttctccacctgggccacccctccccgcttcagcggccccatcccttggaggctct
ggggccccacccccacccccgatgccaccccctccactgggctcccccttccccgtcatc
agttcttccatggggtcccctggcctgccccctccagctcccccaggattctccgggcct
gtcagcagcccccagattaactcaacagtgtcgctccctgggggtggggctggcccccct
gaagatgtgaagccacccgtcttaggggtccggggcctgcactgtccaccccctccaggt
ggccctggagctggcaaacggctgtgtgcaatctgcggggacagaagttcaggcaaacac
tacggggtctacagctgtgagggctgcaagggcttcttcaagcgcaccatccgcaaggac
ctcacctactcgtgccgcgacaacaaggactgcacggtggacaagcgccagcggaaccgc
tgtcagtactgccgctaccagaaatgcctggccacgggcatgaagagggaggcagtacaa
gaggagcgccagcggggcaaggacaaggatggggatggggagggggctgggggagccccc
gaggagatgcccgtggacaggatcctggaggcagagcttgctgtggagcagaagagtgac
cagggcgttgagggccctgggggaaccggggggagcggcagcagtccaaatgaccccgtg
actaacatctgccaggcagctgacaaacagctgttcacgctggttgaatgggcgaagagg
atcccacacttttcctccttgcctctggatgaccaggtcatactgctgcgggcaggctgg
aacgagctcctcattgcttctttctcccaccggtccattgatgtccgagacggcatcctc
ctcgccacgggtcttcacgtgcatcgcaactcagcccattctgcaggcgtgggagccatc
tttgatcgggtgctgacagagctagtgtccaaaatgcgtgacatgaggatggacaagaca
gagcttggctgcctgagggcaatcattctgtttaatccagatgccaagggcctctccaac
cccagcgaggtggaggtcctacgggagaaggtgtacgcctccttggagacctactgcaaa
cagaagtaccccgagcagcagggacggtttgccaagctgctgcttcgtcttcctgctctc
cgctccatcggccttaagtgtctagaacatctgtttttcttcaagctcattggcgacacc
cccatcgacaccttcctcatggagatgcttgaagctccccaccagctggcctga

DBGET integrated database retrieval system