KEGG   Oryctolagus cuniculus (rabbit): 100354455
Entry
100354455         CDS       T03373                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100354455 (IKBKE)
   04621 NOD-like receptor signaling pathway
    100354455 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    100354455 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    100354455 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    100354455 (IKBKE)
   04657 IL-17 signaling pathway
    100354455 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100354455 (IKBKE)
   05164 Influenza A
    100354455 (IKBKE)
   05161 Hepatitis B
    100354455 (IKBKE)
   05160 Hepatitis C
    100354455 (IKBKE)
   05168 Herpes simplex virus 1 infection
    100354455 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354455 (IKBKE)
   05169 Epstein-Barr virus infection
    100354455 (IKBKE)
   05165 Human papillomavirus infection
    100354455 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100354455 (IKBKE)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100354455 (IKBKE)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100354455 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH DUF5798 ABATE TPR_MLP1_2
Other DBs
NCBI-GeneID: 100354455
NCBI-ProteinID: XP_017203317
LinkDB
Position
16
AA seq 711 aa
MQSTASYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTASYLRPREVQEREFEVLR
KLNHQNIVKLFAVEETGGSRQRVLVMEHCSGGSLLSVLESPENAFGLSEDEFLVVLRCVV
AGMNHLRENGVVHRDIKPGNIMRLVGHEGQSVYKLTDFGAARQLLDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFVPYGGPRRNKEIMYRITTE
KPSGAIAGTQRRENGPLEWSYALPVTCRLSMGLQGQLVPILANILEVEPAKCWGFDQFFA
ETSDILQRVTVHVFSLSQAVLHHVYIHAHNTVAVFLEAVCEQTSVGPRQQEYFFEGHPCV
LEPSVSAQHIAHTTASSPLTLFSAASETPKGLAFRDPALDIPKFVPKVDLQADYNAAKGM
LGAGYQALRLARAMLHTQELMLRGLYWVVEVLQTTCRRTLEVTRTALLFLSSSLGTERLD
SAAETPTQQELQGATELRSRLRTLAEVLSRCSQNITETQAGLSRLGAELAKRRAQVHADR
STQQIQCCLDKMNLIYKQFKKSRMSPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECMH
KYQASLVAHGKWMREVHKTRNHLRLVGCSVAACNTEAQGAQESLSKILDQLLQDKAKGAQ
ALPPSTAPPAPQDLALHMQELCREMKLVAFDLQDNNRIIERLGKVTSVPDA
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgcagagcacggccagctacctgtggcacacggatgacctgctggggcagggtgccact
gccagcgtgtacaaggcccgcaacaagaaatccggggagctggtggccgtgaaggtcttc
aacactgccagctacctgcgtccccgggaggtgcaggagagggagtttgaggtcctgcgg
aagttgaaccaccagaacatcgtcaagctcttcgcggtggaggagacggggggcagccgg
cagagggtgctggtgatggagcactgctctgggggcagcctgctgagtgtgctggagagc
ccggagaacgccttcgggctgtcggaggacgagttcctggtcgttctgcgctgtgtggtg
gccggcatgaaccacctgcgggagaacggcgtggtgcaccgcgacatcaagccgggcaac
atcatgcgcctggtgggccacgagggccagagcgtctacaagctcacggacttcggcgcc
gcgcgccagctgctggacgacgagaagttcgtctcggtctacggcaccgaggagtacctg
cacccggacatgtacgagcgggcggtgcttcgcaagccccagcaaaaggcgttcggggtg
accgtggacctctggagcatcggggtgaccctgtaccacgcagccaccggcagtctgccc
ttcgtgccctacggcgggccgcggcgcaacaaggagatcatgtaccggatcaccaccgag
aagccctccggggccatcgcgggcactcagcggcgggagaacgggcccctggagtggagc
tacgccctgccggtcacctgccggctgtccatgggcctgcagggccagctggtgcccatc
ctggccaacatcctggaggtggagccggccaagtgttggggcttcgaccagttcttcgcc
gagacaagcgacatcctgcagcgcgtcaccgtgcacgtcttctccctgtcccaggccgtg
ctgcaccacgtctacatccacgcccacaacacggtggccgtcttcctggaggccgtgtgc
gagcagaccagcgtgggcccccggcagcaggagtacttctttgagggccacccgtgcgtc
ctggagcccagcgtctcggctcagcacatcgcgcacacgactgccagcagccccctgacc
ctgttcagcgcggccagcgagacccccaaggggctggccttcagggaccctgccctggac
atccccaagttcgtccccaaagtggacctgcaggcagactacaatgccgccaagggcatg
ctgggtgccggctaccaggccctgcgcctggcacgggccatgctgcacacacaggagctg
atgcttcgcgggctgtactgggtcgtggaggtgctgcagaccacgtgcaggcggactctg
gaggtcacacggaccgcactcctcttccttagcagcagcctgggcactgagaggctggac
agcgcggctgagacgcccacgcagcaggagctgcagggggccacggagctgaggtccagg
ctgcggactctggccgaggtcctctccagatgttcccaaaatatcacggagacccaggcg
ggcctgagcaggctgggcgcggagctggcgaagaggcgggctcaggtacatgcggacaga
agcacccagcagatccagtgttgtctggacaagatgaacctcatctacaaacagttcaag
aagtctcggatgagcccagggcttggctataacgaggagcagatccacaagctggacaag
gtgaatttcagccacttggccaagaggctgctgcaggtgtttcaggaggagtgcatgcac
aagtaccaggcgtccctcgtcgcgcacggcaagtggatgagggaggtgcacaagaccagg
aaccacctgcgcctggtcggctgttccgtggctgcctgtaacacggaggcccagggtgcc
caggagagcctcagcaagatcctggaccaactcctgcaggataaagccaagggcgcccag
gccttgccaccctccacggctcctcctgcaccccaagacctggccctccacatgcaagaa
ctgtgccgtgagatgaagctggtggcctttgacctccaggacaacaatcgcatcatcgaa
cggttgggtaaggtcacatctgtgcctgatgcctga

DBGET integrated database retrieval system