KEGG   Oryctolagus cuniculus (rabbit): 100354683
Entry
100354683         CDS       T03373                                 

Gene name
STEAP3
Definition
(RefSeq) STEAP3 metalloreductase
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100354683 (STEAP3)
   04115 p53 signaling pathway
    100354683 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100354683 (STEAP3)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     100354683 (STEAP3)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Others
   Others
    100354683 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct Shikimate_DH NAD_binding_2 2-Hacid_dh_C IlvN
Other DBs
NCBI-GeneID: 100354683
NCBI-ProteinID: XP_002712426
Ensembl: ENSOCUG00000013423
UniProt: G1T5D1
LinkDB
Position
7
AA seq 498 aa
MSQLPVVAAAMPGEMDKPLISRCLVDSDGSLAEAPSEAPRVGILGSGDFARSLATRLVCS
GFSVVVGSRNPKRSAGLFPNAVQVTFQEEAVSSPDVIFVAVYREHYSSLCGLSDQLTGKI
LVDVSNPTEQEHLRHHESNAEYLASLFPTCTVVKAFNVISAWTLQSGPRDGNRQVPVCGN
QPEAKRVVSEMAHAMGFMPMDMGSLASAREVEALPLRLLPGWKVPTLLALGLFVCFYAYN
FVRDVLEPYVQEGKNRFYKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLQRGTKYRR
FPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRSHRYELVNLALKQVLANKSHLWV
EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFNFVQSTLGFVALVLSTLHT
LTYGWTRAFEESCYKFYLPPTFTLTLLVPCVVILAKGLFLLPCLSRRLARIRRGWEKGSA
LKFTPPTDNAPVEKTSHV
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtcgcagctgcctgttgttgccgctgcaatgccaggagagatggacaagccactgatc
agccgctgcttggtggacagcgatggcagccttgccgaggcccccagcgaggcccccaga
gtgggcatcctgggcagtggggactttgcccgctcgctggccacacgcctggtgtgctcc
ggcttcagcgtggtcgtaggaagccgcaaccccaagcggtcagccgggctgttccccaat
gcggtgcaggtaacttttcaggaggaggctgtgagctccccggatgtcatcttcgtggct
gtgtaccgggagcactactcctcgctgtgtggtcttagcgaccagctgaccggcaagatc
ctggtggacgtgagcaaccccacggaacaggagcatcttcggcaccacgagtccaacgct
gagtacctggcctccctcttccccacctgcaccgtggtcaaggccttcaacgtcatctct
gcctggaccctacagtctggcccgagggatggaaacaggcaggtgcctgtctgtggcaac
cagccggaagccaagcgtgtggtctcagagatggcgcatgccatgggcttcatgccaatg
gacatgggctccctggcatcagcccgggaggtggaggccttgcccctgcgcctcctcccg
ggctggaaggtgcccaccctcctggccctggggctcttcgtctgcttctatgcctacaac
ttcgtccgagacgtgctggagccctacgtgcaagagggcaagaacaggttctacaagctg
cccgtgtccgtggtcaacaccacactgccatgcgtggcctacgtgctgctgtcgctggtg
tacctgcccggcgtgctggcggctgccctgcagctacagcggggcaccaagtaccgccgc
ttccccgactggctggaccactggctgcagcaccgcaagcagatcgggctgctcagcttc
ttctgcgccgccctgcacgcgctctacagcttctgcctccccctgcgccgctcacaccgc
tacgaactggtcaacctggccttaaagcaggtcttggccaacaagagccacctgtgggtg
gaggaggaagtctggcggatggagatctacctctccctgggcgtgctggccctcggcacg
ctgtccctgctggccgtcacctcgctgccatccatcgcaaactcactcaactggagggag
ttcaacttcgttcagtccacgctgggcttcgtggccctggtgttgagcaccctgcacacg
ctcacctacggctggacgcgcgccttcgaggagagctgctacaagttctacctgccaccc
accttcaccctcacgctgctggtgccctgcgtcgtcatcctggccaagggcctcttcctc
ctgccctgcctcagccgcagactcgccaggatccgcaggggctgggagaagggcagcgcc
ctcaagttcacgccacccacagacaacgcccctgtggagaagaccagccacgtgtga

DBGET integrated database retrieval system