KEGG   Oryctolagus cuniculus (rabbit): 100354937
Entry
100354937         CDS       T03373                                 

Gene name
SMG1
Definition
(RefSeq) SMG1, nonsense mediated mRNA decay associated PI3K related kinase
  KO
K08873  serine/threonine-protein kinase SMG1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100354937 (SMG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100354937 (SMG1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100354937 (SMG1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100354937 (SMG1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100354937 (SMG1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     100354937 (SMG1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100354937 (SMG1)
SSDB
Motif
Pfam: SMG1 PI3_PI4_kinase SMG1_N FATC HEAT
Other DBs
NCBI-GeneID: 100354937
NCBI-ProteinID: XP_008256008
Ensembl: ENSOCUG00000016615
LinkDB
Position
6
AA seq 3661 aa
MSRRAPGSRLSSGGGGGGTKYPRSWNDWQPRTDSASADPDNLKYSSSRDRGGSSSYGLQP
SNSAVVSRQRHDDTRVHTDIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVSSPEFTS
VQHGSRAVATKDMRKSQERSMSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPE
NKLVLVKQLDNILAAVHDVLNESSKLLQELRQEGACCLGLLCASLSYEAEKIFKWIFSKF
SSSTKDEVKLLYLCATYKALETVGEKKAFSSVMQLVMTSLQSILENVDTPELLCKCVKCI
LLVARCYPHIFSTNFRDTVDILVGWHIDHTQKPSLTQQVSGWLQSLEPFWVADLAFSTTL
LGQFLEDMEAYAEDLSHVASGESVDEDVPPPSVSLPKLAALLRVFSTVVRSIGERFSPIR
GPPITEAYVTDVLYRVMRCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTIHCDMVIT
YGLDQLENCQTCGTDYVISVLNLLTLVVEQINTKLPSSFVEKLFIPSSKLLLLRYHKEKE
VVAVAHAVYQAVLSLKNIPVLETAYKLILGEMTCALNNLLHSLQLPDACSEIKHEAFKNH
VFNVDNAKFVVIFDLSALTTIGNAKNSLIGMWALSPTVFALLSKNLMIVHGDLAVHFPAI
QYAVLYTLYSHCTRHDHFISSSLSSSSPSLFDGAVISTVTTATKKHFSIILNLLGVLLKK
DNLNQDTRKLLMTWALEVAVLMKKSETYAPLFSLPSFHKFCKGLLANTLVEDVNVCLQAC
SSLHALSSSLPDDLLQRCVDVCRVQLVHSGTRIRQAFGKLLKSIPLDVVLSNNNHTEIQE
ISLALRSHMSKAPSNTFHPQDFSDVISFILYGNSHRTGKDNWLERLFYSCQRLDKRDQST
IPRNLLKTDAVLWQWAIWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRSLAAHTLNPDQD
VSQWTTADSDEGHGSNQLRLVLLLQYLENLEKLMYNAYEGCANALTSPPKVIRTFFYTNR
QTCQDWLTRIRLSIMRVGLLAGQPAVTVRHGFDLLTEMKTNSLSQGNDLEVTIMMVVEAL
CELHCPEAIQGIAVWSSSVVGKNLLWINSVAQQAEGRFEKASVEYQEHLCAMTGVDCSIS
SFDKSVLTLANAGRNSASPKHSLNGESRKTVLSKPTDSSPEVINYLGNKACECYISIADW
AAVQEWQNAIHDLKKSTSSTSLNLKADFNYIKSLSSFESGEFIECTEQLELLPGENINLL
AGGTKEKIDMKKLLPNMLSPDPRELQKSIEVQLLRSSVCLATALNHVEQDQKWQSITENV
VKYLKQTSRIAIGPLRLSTLTVSQSLPVLSTLQLYCSSALENTVSNRLSTEDCLIPLFSE
ALRSCKQHDVRPWMQALRYTMYQNQLLEKIKEQTVPIRSHLMELGLTAAKFARKRGNVSL
ATRLLAQCSEVQLGKTTTAQDLVQHFKKLSTQGQMDEKWGPELDIEKTKLLYTAGQSTHA
MEMLSSCAISFCKSAKAEYAVAKSILTLAKWIQAEWKEISGQLKQVYRAQQQQHFTGLST
LSKNLLTLLELPSVNTMEEEYPRIESESTVHIGVGEPDFILGQLYHLSSVQAPEVAKSWA
ALASWAYRWGRKVVDNASQGEGVRLLPREKSEVQNLLPDTVTEEEKERIYGILGQAVCRP
AGIQDEDITLQITESEDNEEDDMVDVIWRQLISSCPWLSELDESATEGVIKVWRKVVDRI
FSLYKLSCSAYFTFLKLNAGQIPLDEDDPRLHLSHRVEQSTDDVIVMATLRLLRLLVKHA
GELRQYLEHGLETTPTAPWRGIIPQLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPA
IVGTISLSSESQASGNKFSSAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKSGLN
EDQAMMQDCYSKIVDKLSSANPTMVLQVQMLVAELRRVTVLWDELWLGVLLQQHMYVLRR
IQQLEDEVKRVQSNNTLRKEEKIAIMREKHTALMKPIVFALEHVRSITAAPAETPHEKWF
QDNYGEAIENALEKLKTPVNPAKPGSSWIPFKEIMLSLQQRAQKRASYILRLEEISPWLA
AMTNTEIALPGEVSARDTVTIHSVGGTITILPTKTKPKKLLFLGSDGKSYPYLFKGLEDL
HLDERIMQFLSIVNTMFATINRQETPRFHARHYSVTPLGTRSGLIQWVDGATPLFGLYKR
WQQREAALQAQKAQDSYQTPQNPGIVPRPSELYYSKIGPALKTVGLSLDVSRRDWPLHVM
KAVLEELMEATPPNLLAKELWSSCTTPDEWWRVTQSYARSTAVMSVVGYIIGLGDRHLDN
VLIDMTTGEVVHIDYNVCFEKGKSLRVPEKVPFRMTQNIATALGVTGVEGVFRLSCEQVL
HIMRRGRETLLTLLEAFVYDPLVDWTAGGEAGFAGAVYGGGGQQAESKQSKREMEREITR
SLFSSRVAEIKVNWFKNRDEMLVVLPKLDSSLDEYLSLQEQLTEVEKLQGKLLEEIEFLE
GAEGVDHPSHTLQHRYSEHTQLQTQQRAVQEAIQVKLNEFEQWITHYQAAFNNLEATQLA
SLLQEISTQMDLGPPSYVPATAFLQNAGQAHLISQCEQLEGEVGALLQQRRSVLRGCLEQ
LHHYATVALQYPKAIFQKHRIEQWKTWMEELICNTTVERCQELYRKYEMQYAPQPPPTVC
QFITATEMTLQRYAADINSRLIRQVERLKQEAVTVPVCEDQLKEIERCIKVFLHENGEEG
SLSLASVIISALCTLTRRNLMMEGAASSAGEQLVDLTSRDGAWFLEELCSMSGNVTCLVQ
LLKQCHLVPQDLDIPNPMEASEAVHLANGVYTSLQELNSNFRQIIFPEALRCLMKGEYTL
ESMLHELDSLIEQTTDGVPLQTLVESLQAYLRNAAMGLEEETHAHYIDVARILHAQYGEL
IQPRNGSVDETPKMSAGQMLLVAFDGMFAQVETAFGLLVEKLNKMEIPVAWRKIDIIREA
RSTQVNFFDDDNHRQVLEEIFFLKRLQTIKEFFKLCGTFSKTLSGSSSPEDQNTVNGPVQ
MVSVKTLFRNSCFSEDQMAKPIKAFTADFVRQLLIGLPNQALGLTLCSFISALGVDIIAQ
VEAKDFGAESKVSVDDLCKKAVEHNIQIGKFSQLVMNRATVLASSYDTAWKKHDLVRRLE
TSISSCKTSLQRVQLHIAMFQWQHEDLLINRPQAMSVTPPPRSAILTSMKKKRHTLSQIE
TSIATVQEKLAALEASIEQRLKWAGGANPALAPVLQDFEATIAERRNLVLKESQRASQVT
FLCSNIIHFESLRTRTAEALNLDAALFELIKRCQQMCSFASQFNSSVSELELRLLQRVDT
SLEHPIGSSEWLLSAHKQLTQDMSTQRTIQTEKEQQIETVCETIQNLVDNIKTVLTGHNR
QLGDVKHLLKAMAKDEEAALADGEDVPYENSVRQFLGEYKSWQDNIQTVLFTLVQAMGQV
RSQEHVEMLQEITPTLKELKTQSQSIYNNLVSFASPLVTDATNECSSPTSSATYQPSFAA
AVRSNTGQKTQPDVMSQNARKLVQKNLATSADTPPSAIPGTGKSVACSPKKAVRDPKTGK
AVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAW
V
NT seq 10986 nt   +upstreamnt  +downstreamnt
atgagccgcagagccccggggtctcggctgagcagcggcggcggcggcggcggcaccaag
tacccgcggagctggaatgactggcaacccagaactgatagtgcatcagccgacccagat
aatttaaaatattcttcatccagagataggggtggttcttcttcttatggactgcaacct
tccaattcagctgtggtgtctcggcaacggcatgatgataccagagttcatacagacata
cagaatgacgaaaagggtggctacagtgtcaatggaggctctggggaaaatacttatggt
cggaagtcgttggggcaagagctgagggtgaacaatgtgagcagccctgagttcaccagt
gttcagcatggcagtcgtgctgtagccaccaaagacatgaggaaatcacaggagcgatcg
atgtcttactctgatgagtctcgactgtcgaatcttcttcggaggatcacccgggaagat
gacagagaccgaagactggctactgtaaagcagttgaaagaatttattcagcaaccagag
aataaactggtactagttaaacagttggataatatcttggctgctgtacatgatgtgctt
aatgaaagcagcaaattgcttcaggagttgaggcaggagggagcttgctgtcttggcctt
ctttgtgcttctctgagctatgaggctgagaagatcttcaagtggatttttagcaaattt
agctcatctacaaaagatgaagttaaactgctctacttatgtgccacctacaaagcactg
gagactgtaggagagaagaaagccttttcgtctgtgatgcagctcgtaatgaccagcctg
cagtccattcttgaaaatgtggatacaccagaattactttgcaaatgtgttaaatgcatt
cttttggtggctcgatgttaccctcatattttcagcactaactttagggatacggttgat
atattggtcggatggcacatagatcatacccagaaaccttcgctcacacagcaggtatct
gggtggttgcagagtttggagccattttgggtggctgatctggcattttccaccactctt
cttggtcagtttctagaagacatggaggcatatgctgaggacctcagccatgtggcctct
ggtgaatctgtggatgaagatgttcctcctccatcagtgtcattaccaaagctggcagct
cttctccgggtatttagtactgtggtgaggagcattggggaacgcttcagcccaatacgg
ggtcctccaattactgaggcatatgtaacagatgttctgtacagagtaatgagatgtgtg
acggctgcaaaccaagtgtttttttctgaggctgtgttgacagctgctaatgagtgtgtt
ggtgttttgctcggcagcttggatcctagcatgactatacattgtgacatggtcattaca
tatggattagaccagctggagaactgccagacttgtggtaccgattatgtcatctcggtc
ttgaatttactcacattggttgtggaacaaataaatacaaaactgccatcatcatttgtg
gaaaaactctttataccatcatctaaactattacttttgcgttatcataaagaaaaagag
gttgttgctgtagcccatgctgtatatcaagcagtgctcagcttgaagaatattcctgtt
ttggagactgcctataaattaattttgggagaaatgacttgtgcactgaacaacctgcta
catagtttacaacttcctgatgcctgctctgaaataaaacatgaagcttttaagaatcat
gtattcaatgtagacaatgcaaaatttgtggttatatttgaccttagtgccctgaccaca
attggaaatgccaaaaactcgctaattgggatgtgggcgctctctccaactgtctttgca
cttctgagtaagaatctgatgattgtgcatggcgacctggctgttcacttcccggccatc
cagtatgcagtgctctacaccttgtactcgcattgtaccaggcacgatcactttatatct
agtagtctgagttcttcatccccttccttgtttgatggagctgtgattagtactgtgact
acagctacaaagaagcatttctccattatattaaaccttctgggagtcttgcttaagaag
gataaccttaaccaggatacaaggaaactgttaatgacttgggctttggaagtggctgtt
ctaatgaagaagtctgaaacatatgctcctttattctctcttccatcttttcataagttt
tgcaaaggccttttagccaacactcttgttgaggatgtgaacgtctgtctgcaagcatgc
agcagtctgcatgctctgtcctcgtccttgccggatgatcttttacagagatgtgttgat
gtttgccgggtccagctagtccatagtgggacccgtattcgacaggcgtttgggaaactg
ttgaagtcaattcctttagacgttgttctgagcaataacaatcacacagaaattcaagaa
atttctttagcattgagaagtcacatgagtaaagcaccaagtaatacattccacccacaa
gatttctcagacgttattagttttattttgtatgggaattcccatagaacagggaaggac
aattggttagaaagattgttctatagctgccagagattggataagcgtgaccagtccaca
atcccccgcaatctcctgaagacagatgccgtcctttggcagtgggctatttgggaagca
gcacaattcactgtcctttctaagctgagaactccactgggcagagctcaagacaccttc
caaacaattgaaggtataattagaagtcttgcagctcacacattaaaccccgatcaagat
gttagtcagtggacaactgcagacagtgatgaaggccatggtagtaaccaacttagactt
gttcttcttctgcagtatctggaaaatctggagaaattaatgtataatgcatacgaggga
tgtgctaatgcattaacatcgcctcccaaggtcattaggacttttttctacaccaatcgc
caaacttgtcaagactggctaactcggatccgactctccatcatgagggttgggttgttg
gcaggccagcctgcagtgacagtaaggcatggctttgacttgcttacagaaatgaagaca
aatagtctgtctcaggggaatgatttggaagtgactataatgatggtggtagaagcgctg
tgtgaacttcattgtcctgaagccatacaaggaattgctgtgtggtcatcttctgttgtt
ggaaaaaatcttctctggattaactcagtggctcaacaggctgaaggcaggtttgaaaag
gcctcagtggagtaccaggagcacctgtgtgccatgacaggtgttgattgttccatctcc
agcttcgacaagtctgttctcactctggccaatgctgggcgcaacagtgccagtcccaag
cattctctgaacggtgaatcaagaaaaactgtgctgtccaagccaactgactcttcccct
gaggttataaattatctaggaaataaagcctgtgagtgttacatttcaattgctgattgg
gctgcggtacaggaatggcagaatgctatccacgacttgaaaaagagtaccagtagcact
tccctcaacctaaaagctgatttcaactacataaaatcactaagcagttttgagtctgga
gaatttattgaatgtactgagcaattagagttgttaccaggagaaaatatcaatctactt
gctggaggaacaaaagaaaaaatagatatgaaaaaactgcttcctaacatgctaagtcca
gatccaagggaacttcagaaatccattgaagttcagttgttgagaagttctgtttgtttg
gcaactgctttaaaccatgtagaacaagaccagaagtggcagtctataacagaaaatgtg
gtaaagtacttgaagcaaacatctcgcatagctattggaccactgagactttctacttta
acagtttctcagtccttgccagttctaagtaccttacaactgtattgttcatctgctctt
gaaaatacggtttctaacagactttcaacagaggattgtcttattccactcttcagtgaa
gctttgcgttcatgtaaacaacatgacgtgaggccttggatgcaggcattaagatacacc
atgtaccagaatcagttgttggagaaaattaaagaacaaacagtcccaattagaagccat
ctcatggaattaggtctaacagcagcaaaattcgctagaaaacgggggaatgtgtcactt
gcaacaagattactggcacagtgcagtgaagttcagctgggaaagaccactactgcacag
gatttagtgcagcattttaaaaaactgtcaactcaaggtcagatggatgagaagtggggg
cctgaacttgatattgagaaaaccaaattgctatatacagcaggccagtcaacacatgca
atggaaatgttgagttcttgcgccatatctttctgcaagtctgcgaaagctgaatatgca
gttgcaaagtcaattctgacgctggctaaatggatccaggcggagtggaaagagatctca
ggacagctgaagcaggtgtacagagctcagcagcagcagcacttcacaggcctttctact
ctgtctaaaaacttactcactctcctagaactgccatctgtgaacaccatggaagaagag
tatccccggatcgagagtgaatctacagtacatattggagttggagaacctgacttcatt
ttgggacagctgtatcacctgtcttcagtacaggcacctgaagtagccaaatcttgggca
gcattggctagttgggcttacaggtggggcagaaaggtggtcgacaatgccagtcaggga
gaaggtgttcgactgctgcctagagaaaaatctgaagttcaaaatctgcttccagacact
gtaactgaagaggagaaagagagaatatatggtatccttggacaggctgtgtgtcgacca
gcgggaattcaggatgaagatataacacttcagataacagagagtgaagataatgaggaa
gatgacatggttgatgtaatttggcgtcagttaatatcaagctgcccctggctttcagaa
cttgatgaaagtgcaactgaaggagttattaaagtgtggagaaaagttgttgatagaatc
ttcagcctgtacaaactgtcttgcagtgcatattttacgttccttaaacttaacgctggt
cagattcctttagatgaggatgacccgaggctacatctaagtcacagagtggagcagagc
actgacgatgtgattgtgatggccaccttgcgactgctcaggttgcttgtgaaacatgct
ggggagctccggcagtatctggaacatggcttggaaacaacacctacggctccttggaga
ggaattattccacagctcttctcacgcttaaaccaccctgaggtgtatgtgcgccagagt
atttgtaaccttctgtgccgggtggctcaagactccccacatctcatcctctaccctgcg
atagtgggcaccatatcacttagtagtgaatcccaggcttcaggaaataaattttcttct
gcaattccaactttacttggcaatattcaaggagaagaattgctggtttctgaatgtgag
ggaggaagtcctcctgcttctcaggatagcaacaaggatgaacctaaaagtggattaaat
gaagaccaagccatgatgcaggactgctacagcaaaattgtagataagctgtcctctgca
aacccaactatggtgttacaggttcagatgcttgtggctgagctgcgcagggtcaccgtg
ctctgggatgagctctggctgggagttctgctgcagcagcatatgtatgtcttgagacgg
attcagcagcttgaagatgaagtgaagagagtccagagcaacaacaccctgcgcaaagaa
gagaagattgcaatcatgcgagagaagcacacggctctgatgaagcccattgtgtttgct
ttggagcatgtgaggagtatcacggcagcccctgcagaaacaccgcatgaaaagtggttt
caggataactatggtgaagcaattgagaatgccctggaaaagctgaagacgccagtaaat
cccgccaagccaggaagcagctggattccatttaaagagataatgctgagtttgcaacag
agagcgcagaaacgagcaagttacattttgcgtcttgaagaaatcagtccgtggttggct
gccatgactaacactgaaattgcgcttcctggggaggtctcagccagagacactgtcaca
atccacagtgtgggtggaaccatcacaatcctaccaaccaaaaccaagccaaagaaactg
ctctttctaggatcagatgggaagagctatccctatcttttcaaaggactggaggattta
catctggatgagagaataatgcagttcttatccattgtgaataccatgtttgctacaatt
aatcgtcaagaaacaccccgtttccatgcgcgacactattctgtaacaccactaggaaca
agatcaggcttgatccagtgggtggatggagccacacccttgtttggcctttacaaacga
tggcaacagcgagaagctgctttacaagcacaaaaggcccaggattcctaccagactcct
cagaatcctggaattgtaccccgtcctagtgaactttattatagtaaaattggccctgcc
ttgaaaacagttggacttagcctagatgtgtcacgtcgcgactggcctcttcacgtaatg
aaggcagtattagaagagttaatggaggccacacccccaaatctccttgccaaagagctg
tggtcatcttgtacaacacctgacgagtggtggagagttacacagtcttatgcgagatct
actgcagtcatgtctgtggttgggtacataatcggccttggagatagacatctggataat
gtcctcatagatatgacgactggagaagttgttcacatagattataatgtttgctttgaa
aaaggtaaaagccttagagttcctgagaaagtgccttttcgaatgacacaaaacattgca
acagcattgggtgttactggagtagaaggtgtttttaggctttcgtgtgagcaggttctg
cacatcatgcgacgtggcagagagactctgctgaccttgctggaagcctttgtgtatgac
cccctggtggactggacagcaggaggcgaggctgggtttgctggcgctgtgtatggcgga
ggtggccagcaagctgagagcaagcagagcaagagagagatggagcgagagatcacacgc
agcctcttttcttccagagtagctgagattaaggtgaactggtttaagaatagagatgag
atgctggttgtgcttcccaagctggacagtagcttagatgaatacctaagcttgcaagag
caactgacagaggtggagaaactgcagggcaaactactggaggaaatagagtttctagaa
ggagctgaaggcgtggatcatccttctcatactctgcaacacaggtattctgaacacact
caactacagactcagcaaagagcagttcaggaagcaatccaagtgaagctgaacgaattt
gagcagtggataacgcattaccaagctgcattcaacaatttagaagcaacacagcttgca
agtttgcttcaggagataagcacacaaatggaccttggtcccccaagctatgtgcccgca
acagcctttctgcagaacgctggccaggcccacttgattagccagtgtgagcagctggag
ggggaggttggcgcgctcctgcagcagaggcgttctgtgctccgtggctgtctggaacag
ctgcatcactatgcaactgtagccctgcagtatcccaaagccatatttcagaaacaccgg
attgaacagtggaaaacctggatggaagagctcatttgtaacaccacagtagaacgctgt
caagaactctacaggaaatatgaaatgcagtatgctccccagccacctccaacagtgtgt
cagttcattaccgccactgaaatgaccctgcagcggtatgcagcagacataaacagcaga
cttatcagacaagtggaacgcttgaaacaagaggctgtcacagtgccagtttgtgaagat
cagttgaaagaaattgaacgttgcataaaagttttccttcatgagaatggagaagaaggg
tctctgagtctagcgagtgttattatttctgccctttgtacccttacaaggcgtaacctg
atgatggaaggtgcagcttcgagtgctggagagcagctggttgacctgacttctcgagat
ggagcctggttcttggaggagctctgcagcatgagtggaaatgtcacctgcttggttcag
ttactgaagcagtgtcacctggtgccacaggacttggacatcccaaaccccatggaagca
tctgaagccgttcacttagccaatggagtgtacacctcacttcaggaattgaattcaaat
ttccggcaaatcatatttccagaagcacttagatgcttaatgaaaggtgaatacacattg
gaaagtatgcttcatgagttggacagtcttattgagcagacaactgatggtgttcctctg
cagactctagttgaatctcttcaagcctatttgagaaatgcagctatgggactcgaagaa
gaaacacatgctcattacattgatgttgccagaatactgcatgctcaatatggggaatta
atccaaccaagaaacggttcagttgatgaaacaccgaaaatgtcagcgggccagatgctt
ctggtagcatttgatggaatgtttgcccaagttgaaactgcgtttggcttattagttgaa
aagttaaacaagatggaaattcctgtagcatggcgaaagatcgacatcataagggaagcc
aggagtacccaagttaatttttttgatgatgataatcaccggcaggtcttagaagagata
ttctttctaaaaagactacagacaattaaggaatttttcaagctctgcggtaccttttct
aaaacgttgtcaggatcaagctcacctgaagatcagaataccgtgaatggtcctgtacag
atggtcagtgtgaaaaccctgtttagaaattcttgcttcagtgaagaccagatggccaag
cctatcaaagccttcacagcggactttgtgaggcagctcttgatagggctacccaaccaa
gcccttggactcacactgtgcagttttatcagtgctctgggtgtggacatcattgctcaa
gtggaagcaaaggattttggtgctgaaagcaaagtgtctgttgatgatctgtgtaagaaa
gcagtggagcacaacatccagatcgggaagttctcgcagttggtcatgaacagggccact
gtgttagcgagctcctacgacaccgcctggaagaagcatgatctggtgcgcaggttggaa
accagtatttcttcttgcaagacaagtctgcagcgggttcagctgcatattgccatgttt
cagtggcaacatgaagatctgcttatcaacagaccccaggccatgtcagtcacccctccc
cctcggtctgctatcctaaccagcatgaagaagaaacggcacactctgagccagattgaa
acttccattgcaacagtccaggagaaactagcagcactggaagcaagtattgagcagcga
ctcaaatgggcagggggtgccaaccctgcattggcacctgtactacaagattttgaagca
acaatagctgagagaagaaatcttgtccttaaagagagccagagagcaagtcaggtcacc
tttctttgcagcaatatcattcattttgaaagtttacgaacaagaactgcagaagcctta
aacttggacgctgcattatttgaactaatcaaacggtgccagcaaatgtgttcatttgca
tcacagtttaacagttcagtctctgagttagagcttcgtttattacagagagtggacacc
agtcttgaacatcctattggcagctctgagtggcttttgtcagcacacaagcagttgacc
caggatatgtctacccagaggacaattcagaccgagaaagagcaacaaatagaaacagtc
tgtgaaacaattcagaatctggtcgataacataaagacggtgctcactggtcataaccgg
cagcttggagacgtcaaacatctcctcaaagcaatggctaaggatgaagaagctgctctg
gcagatggtgaagatgttccctatgagaacagtgttaggcagtttttgggtgaatataaa
tcatggcaagacaacattcagacagttctgttcacgttagttcaggctatgggtcaggtt
cgaagtcaagaacatgtggaaatgctccaggaaatcactcccaccttgaaagaactgaaa
acacaaagtcagagtatctataataacttagtgagttttgcatcaccattagtcaccgat
gcaacaaacgaatgttccagtccaacatcatctgctacttaccagccttcttttgctgca
gcagtccggagcaacactggccagaagactcagcctgatgtgatgtcacagaatgcccga
aagctggttcagaaaaatcttgctacatcagcagatactccaccaagtgccattccagga
actggaaagagtgttgcttgtagtcctaaaaaggctgtcagagatcctaaaactgggaaa
gctgtgcaagaaagaaactcatatgcagtgagtgtgtggaagagagtgaaagccaagcta
gagggccgggatgttgatcccaacaggaggatgtcagttgctgaacaggttgactatgtc
attaaggaagcaactaatctagataacttggctcagctgtatgaaggttggacagcctgg
gtatga

DBGET integrated database retrieval system