KEGG   Oryctolagus cuniculus (rabbit): 100354982Help
Entry
100354982         CDS       T03373                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05034  Alcoholism
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100354982 (HDAC6)
  09165 Substance dependence
   05034 Alcoholism
    100354982 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100354982 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100354982 (HDAC6)
   04131 Membrane trafficking [BR:ocu04131]
    100354982 (HDAC6)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100354982 (HDAC6)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100354982 (HDAC6)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100354982 (HDAC6)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100354982 (HDAC6)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100354982 (HDAC6)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100354982 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-GeneID: 100354982
NCBI-ProteinID: XP_008270807
Ensembl: ENSOCUG00000010141
LinkDB All DBs
Position
X
AA seq 1257 aa AA seqDB search
METKSSGTRGPTGRREVGGGRRGRSLSSGPRLESGSGRIGRHRQQGRENRTRAEISPTMS
STGPESTTARSRRSRHNPQSSPHDSSGTPKRSVKKGALPRCSPNLLEIKKKGKMKKLSQA
AEEYLITGLQELDLDSEAKTPAGTGLVFDDQLNEFHCLWDDSFPEGPERLHAIKEQLIQE
GLLDRCVSFHARFAEKEELMLVHSLEYIDLMESTQYMKEGELRVLADTYDSVYLHPNSYS
CACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKH
GIQRVLIVDWDIHHGQGTQFMFDQDPSVLYFSIHRYEQGRFWPHLPASNWSTTGFGQGQG
YTINVPWNQVGMRDADYIAAFLHILLPVAFEFQPQLVLVAAGFDALQGDPKGEMAATPAG
FAQLTHLLMGLAGGKLILSLEGGYNLRSLAEGVSASLHTLLGDPCPMLESPGIPCQSAQN
SLSCTLGALEPFWEFLVRSVETIEEDSMEEDSMEESEESGFWEPPVLPMLTWPVLQARTG
LVYDQRMMSHCNLWDNHHPETPQRILRIMCHLEELGLAGRCLNLPARPATDAELLTCHSA
EYVERIRATQKMKTRELHREGANFDSIYICPSTFTCAQLATGTVCRLVEAVLEGEVLNGV
ALVRPPGHHAEQDAACGFCFFNSVAVAARHAQAISGRALRVLIVDWDIHHGNGTQHIFED
DPSVLYISLHRYDQGTFFPVGDEGACSQMGRAAGTGFTVNVAWNGSRIGDADYLMAWHRL
VLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLAGGRIILILEGGY
NLTSISESMAACTRSLLGDPPPMLALLRPPQSGALASITETIQVHRKYWRSLWVMKVEDK
EGLFSFKSATKKPPRPANRGPAEGMTTPEKNVLEAGTGKATSALSAGESIPGHTESETAV
MLPEAHSSQAATRLATLYHTTSEVGMGGAMMDQTTWEAATGVATPDQTTSEESVGGTSLD
QTTSEVSMGEAMLDSIISEEGDTLNQNTSEEAVRAAKLIQTPLASSIDNQTPPTSPVPGA
ISQISPSQLTRSLRTLKLSDEAQKTSESQIPEEEGLLAEAAGGRDVDDVTLMQGPGNLAD
TDQAMFYAVTPMSWCPHLVAVSPKPATGLNVTQPCQDCGTLEENWVCLSCYEVYCSRFVN
AHMIQHHEASGHPLVLSYVDLSAWCYLCQAYVHHQALLDVKNTVHQNKFGEDMPHPH
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaagttccggcacccgcggccccacaggtcgtcgagaagttggcggcggc
cgcagagggcggagtttgagtagtgggccgcgcctagagagcggctctggaagaattggc
cggcatcgacagcaagggcgggaaaaccgcaccagggccgaaatctcccccaccatgtcc
tccactggcccggagtccaccacagccaggtcccgaaggagtaggcacaacccccagtcg
tcccctcacgactccagcggcaccccgaaacgaagtgttaagaagggcgctttacctcgc
tgcagtcccaacctgctagagataaagaagaaaggcaaaatgaagaagctcagccaagca
gctgaagaatacctaatcacggggctgcaagagctggatctggactctgaggccaagacg
ccggctggcactggtttggtgttcgatgatcagctcaatgaattccactgcctctgggat
gacagtttcccagaaggtcctgagcggctccatgccatcaaggagcaactgatacaggag
ggcctcctggatcgctgtgtatcctttcacgcgcggtttgcagaaaaggaggagctgatg
ttggttcacagcctagaatacattgatctgatggagtcgactcagtacatgaaagaaggg
gaactccgtgtcctagcagacacctatgactcagtatatctgcatccgaactcatactcc
tgtgcctgcctggcttcaggttctgtcctcaggctggtggatgcagtcctgggggctgag
atccggaatggcatggccatcatcaggcctcctggacaccacgcccagcacagtcttatg
gatgggtattgcatgttcaatcacgtggctgtggctgctcgttatgctcaacagaagcat
ggcatacagagggtccttattgttgactgggatatacaccacggtcaaggaacacagttc
atgtttgaccaggaccccagtgttttatatttctccatccaccgctatgagcaaggtcga
ttctggccccatcttccagcctctaactggtccaccacaggtttcggccaaggtcaagga
tataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactacattgctgcg
ttcctgcacatcctgctgccagtcgcctttgagttccaacctcagctggtccttgtggct
gctggatttgatgctctccaaggggaccccaagggcgagatggctgccactccagctggg
ttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctgatcctgtctctg
gagggtggctacaacctccgttccctggcggagggcgtcagtgcctcgctccataccctt
ctgggagacccttgccccatgctggagtcccctggtatcccctgccaaagtgcccagaat
tcactctcctgtactttgggagcccttgagcccttctgggaattccttgtgcgatcagtt
gagaccatcgaggaagacagcatggaggaggacagcatggaggagagtgaggagtccgga
ttctgggagcccccggtgctgcctatgctgacatggccggtgctgcaggctcgcacaggg
ctggtctatgaccagcggatgatgagtcactgcaacttatgggacaaccaccatcccgag
acaccccagcgtatcttgcgtatcatgtgccatctggaggagttgggccttgctggacgc
tgcctcaacctaccagcacgacctgccactgatgctgagctgctcacttgccacagtgct
gagtatgtggagcgtatccgggccacgcagaagatgaagacccgggaactacatcgcgag
ggtgccaactttgactcaatctacatctgccccagcaccttcacctgtgcacagcttgcc
actggcaccgtctgccgcctggtggaggctgtgctggaaggagaggttttgaatggcgtt
gccctggtacgccccccaggacaccatgctgagcaggatgccgcttgtggtttctgcttt
ttcaactctgtggcagtggctgctcgccatgcccaggccatcagtggacgtgccctgcgg
gtcctgattgtggattgggacatccatcatggtaatgggactcagcacatttttgaggat
gaccccagtgtgctctacatatccctgcaccgctatgatcagggcaccttcttccccgtg
ggggatgagggtgcctgcagccagatgggccgggctgcgggcacaggtttcactgtcaac
gtggcctggaatgggtcccgcataggggatgctgactacctgatggcctggcatcgtctg
gtgcttcccattgcatacgagtttaacccagaactggtactggtctcagcgggctttgat
gctgcacgaggagacccactggggggctgccaggtgtcacctgagggttatgcccacctc
acccacctgttgatgggccttgctggtggccgcattatccttatcctagagggtggctat
aacctaacatccatctcggagtctatggctgcctgcacccgctcccttcttggagaccca
ccacccatgctggccctgctgcgacccccacaatcaggggccctggcctcaatcactgag
accatccaggtccatcgcaaatactggcgcagcctgtgggtcatgaaggtagaagacaag
gagggactgttcagttttaagtcagctaccaagaagccacctcgaccagctaatcgtggg
ccagctgaggggatgaccacaccagaaaagaatgttctggaagcaggcacggggaaggcc
acctcagccctatctgcaggagagtccattccaggccatactgaatcagagacagctgtg
atgctccctgaggcccattcctcacaggcagccacaaggttagccaccctgtaccacacc
acctcagaggtgggcatgggaggagccatgatggaccagaccacctgggaagcagccaca
ggggtagccacaccagaccagaccacctcagaggagtctgtgggcggaacctcactggac
cagaccacctcagaggtttccatgggggaagccatgctggacagtatcatttcagaggaa
ggagacacgctgaaccagaacacctcagaggaggctgtgagggcagccaagctgatccaa
actcctctagcctcaagcatagataaccagacgcccccaacctcacctgtgccaggagcc
atatcccagatatcccctagtcagctgactaggagtctcagaaccttgaaactaagcgat
gaagctcagaagacctcagaatctcagattccagaagaggagggcctactagcagaggca
gctggaggtcgggatgtggatgatgtgacactgatgcagggaccagggaaccttgctgac
actgaccaggccatgttttatgctgtgacaccaatgtcctggtgtcctcatttggtggca
gtaagccccaaacctgcaacaggcctgaatgtgactcaaccttgtcaagactgtggaaca
ctcgaggaaaattgggtgtgtctgtcttgctatgaggtctactgcagccgttttgtcaat
gcccatatgatccaacaccatgaagcctctggacacccactggtcctcagctacgttgac
ctgtctgcctggtgttacctctgccaggcctatgtccaccaccaggctctcctagatgtg
aagaacacggtgcaccagaacaagtttggggaggacatgccccacccacactaa

DBGET integrated database retrieval system