KEGG   Oryctolagus cuniculus (rabbit): 100355156Help
Entry
100355156         CDS       T03373                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04213  Longevity regulating pathway - multiple species
ocu04330  Notch signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05016  Huntington's disease
ocu05034  Alcoholism
ocu05165  Human papillomavirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100355156 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100355156 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100355156 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    100355156 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100355156 (HDAC1)
   05202 Transcriptional misregulation in cancers
    100355156 (HDAC1)
   05203 Viral carcinogenesis
    100355156 (HDAC1)
   05220 Chronic myeloid leukemia
    100355156 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100355156 (HDAC1)
  Substance dependence
   05034 Alcoholism
    100355156 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100355156 (HDAC1)
   05165 Human papillomavirus infection
    100355156 (HDAC1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100355156 (HDAC1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100355156 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100355156 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100355156 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100355156 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100355156
NCBI-ProteinID: XP_002720761
Ensembl: ENSOCUG00000003674
UniProt: G1SK67
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKDKDAEEKKEVAEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaggaggaaagtctgttactactacgacggtgatgttggg
aattactactatggacaaggccatccaatgaagcctcaccggatccgcatgactcacaac
ttgctgctcaactatggtctctaccggaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgacgactacattaagttcttgcgctccattcgt
ccggataacatgtccgagtacagcaagcagatgcagcgattcaacgttggtgaggactgt
ccagtatttgatggcctgtttgaattttgtcagttgtctactggtggctctgtagcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgaccgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaaa
tattatgctgttaactacccgctccgagatgggattgacgacgagtcctatgaagccatt
ttcaagccggtcatgtccaaagtgatggagatgttccagcctagcgccgtggtcttacag
tgtggctcagactccctgtctggggatcggctgggttgcttcaatctgaccatcaaaggg
cacgccaagtgtgtggaatttgtcaagagcttcaacctgcccatgctgatgctgggagga
ggcggttacaccatccgcaatgtcgcccggtgctggacatacgaaaccgccgtggccctg
gacacagagatccctaatgagcttccatacaatgactacttcgaatactttgggccagat
ttcaagcttcacatcagtccttccaatatgacgaaccagaacactaatgagtatctggaa
aagatcaaacagcggctgttcgagaacctgaggatgctgccgcacgcgcctggggtccaa
atgcaggcgattcctgaggatgccatcccggaggagagtggcgatgaggatgaagaagac
cctgacaagcgcatctcgatctgttcctctgacaaacgaattgcctgtgaggaggagttt
tccgactccgatgaggagggagagggcgggcgcaagaattcttccaacttcaagaaagcc
aagagagtcaaaacagaagatgaaaaagacaaagatgctgaagagaagaaagaagtcgca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaggaggtcaag
ctggcctga

DBGET integrated database retrieval system