KEGG   Oryctolagus cuniculus (rabbit): 100355543
Entry
100355543         CDS       T03373                                 

Gene name
DNAJC3
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C3
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100355543 (DNAJC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100355543 (DNAJC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100355543 (DNAJC3)
Chaperones and folding catalysts [BR:ocu03110]
 Heat shock proteins
  HSP40 / DNAJ
   100355543 (DNAJC3)
SSDB
Motif
Pfam: TPR_1 TPR_19 TPR_2 DnaJ TPR_16 TPR_14 TPR_8 TPR_11 TPR_9 TPR_17 TPR_12 TPR_20 ANAPC3 TPR_21 TPR_6 PRAI TPR_10 Ndufs5
Other DBs
NCBI-GeneID: 100355543
NCBI-ProteinID: XP_008258331
Ensembl: ENSOCUG00000017619
UniProt: G1TE27
LinkDB
Position
8
AA seq 497 aa
MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIELKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSENEEKEARSQLTKSDEMQLLRSQALDAFESADYAAAITFLDKM
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPN
VAEYTIRSKERICHCFSKDEKPVEAIRVCSEVLQVEPDNVNALKDRAEAYLIEEMYDEAI
QDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFPQ
ELELVAGVQSLQLRRTV
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtggcccccggctcagtgaccagccggctgggctcagtgttccccttcctgctggtc
ctggtggacctgcagtacgaaggtgctgaatgtggagtaaatgcagatgttgagaagcat
cttgaattgggcaagaagttacttgcagctggtcagctggctgatgccctatctcagttt
catgctgcagtagatggtgatcctgataactatattgcttactatcggagagctactgtc
tttctagctatgggcaaatcaaaagctgcacttcctgatttaactaaagtgattgaattg
aagatggatttcactgcagcaagattacagagaggtcatttattactcaaacaaggaaaa
cttgatgaagcagaagatgattttaaaaaagtgctcaaatctaatccaagtgaaaatgaa
gaaaaggaagcccggtctcagctcacgaagtctgatgagatgcagcttttgcgctcacaa
gcacttgatgcttttgaaagtgcagactatgcggctgctataaccttccttgataagatg
ttggaggtttgtgtttgggatgctgaacttcgggaacttcgagctgaatgttttataaaa
gaaggggagcctagaaaagctataagtgacttaaaagctgcatcaaaattgaagaatgat
aatactgaggcattttataaaatcagcacactgtactaccaactaggggaccatgaactg
tccctcagtgaagttcgtgaatgccttaaacttgatcaggatcataaaaggtgctttgcg
cactataaacaagtcaagaaacttaacaagctgattgagtcagctgaagagcttatcaga
gatggcagatacacagatgcgaccagcaaatatgaatcagtcatgaaaacagagccaaat
gttgctgaatatacaattcgttcaaaagaaaggatctgccactgtttttctaaggatgag
aagcctgttgaggcaattagagtgtgttctgaagttttacaggtggaacccgacaatgtg
aatgctctgaaagatcgagcagaagcctatttaatagaagaaatgtatgatgaagctatt
caggattatgaaacagctcaggaacacaatgaaaatgatcaacagattcgggaaggttta
gagaaagcacaaagactattgaaacagtcgcagaaacgagattattataaaatcttggga
gtaaaaagaaatgccaaaaaacaagaaatcattaaagcatacagaaaattagccctacag
tggcacccagataacttccagaatgaagaagaaaagaaaaaagcagagaaaaagttcatt
gatatagcagctgctaaagaagtcctctcagatccagaaatgcggaagaagttcgatgac
ggagaagaccccctggatgcggagagccagcaaggaggcggcggcaacccctttccacag
gagctggaactcgtggcaggggttcaatcccttcagctccggcggaccgtttag

DBGET integrated database retrieval system