KEGG   Oryctolagus cuniculus (rabbit): 100355675
Entry
100355675         CDS       T03373                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04071  Sphingolipid signaling pathway
ocu04115  p53 signaling pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04722  Neurotrophin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100355675 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100355675 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100355675 (BAX)
   04215 Apoptosis - multiple species
    100355675 (BAX)
   04217 Necroptosis
    100355675 (BAX)
   04115 p53 signaling pathway
    100355675 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100355675 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100355675 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355675 (BAX)
   05202 Transcriptional misregulation in cancer
    100355675 (BAX)
   05203 Viral carcinogenesis
    100355675 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100355675 (BAX)
   05212 Pancreatic cancer
    100355675 (BAX)
   05225 Hepatocellular carcinoma
    100355675 (BAX)
   05226 Gastric cancer
    100355675 (BAX)
   05214 Glioma
    100355675 (BAX)
   05216 Thyroid cancer
    100355675 (BAX)
   05220 Chronic myeloid leukemia
    100355675 (BAX)
   05217 Basal cell carcinoma
    100355675 (BAX)
   05218 Melanoma
    100355675 (BAX)
   05213 Endometrial cancer
    100355675 (BAX)
   05224 Breast cancer
    100355675 (BAX)
   05222 Small cell lung cancer
    100355675 (BAX)
   05223 Non-small cell lung cancer
    100355675 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100355675 (BAX)
   05014 Amyotrophic lateral sclerosis
    100355675 (BAX)
   05016 Huntington disease
    100355675 (BAX)
   05020 Prion disease
    100355675 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100355675 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100355675 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100355675 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100355675 (BAX)
   05152 Tuberculosis
    100355675 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100355675 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100355675 (BAX)
   05162 Measles
    100355675 (BAX)
   05164 Influenza A
    100355675 (BAX)
   05161 Hepatitis B
    100355675 (BAX)
   05160 Hepatitis C
    100355675 (BAX)
   05168 Herpes simplex virus 1 infection
    100355675 (BAX)
   05163 Human cytomegalovirus infection
    100355675 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355675 (BAX)
   05169 Epstein-Barr virus infection
    100355675 (BAX)
   05165 Human papillomavirus infection
    100355675 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100355675 (BAX)
   01524 Platinum drug resistance
    100355675 (BAX)
   01522 Endocrine resistance
    100355675 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100355675 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100355675 (BAX)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100355675 (BAX)
Transporters [BR:ocu02000]
 Other transporters
  Pores ion channels [TC:1]
   100355675 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100355675
NCBI-ProteinID: XP_002723742
Ensembl: ENSOCUG00000006423
UniProt: G1SQZ2
LinkDB
Position
Un
AA seq 192 aa
MDGSGEQSRGGGPTSSEQIMKTGALLLQGFIQDRASRMGGQTPELAVAQGPQDESTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFATKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTLTILGAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagtccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggaccgggccagccggatggggggg
cagacgcccgagctggctgtggcgcaggggccccaggacgagtccaccaagaagctgagc
gagtgtctcaagcgcattggcgacgaactggacagtaacatggagctacagaggatgatc
gctgccgtggacacggactccccccgcgaggtctttttccgagtggcagccgacatgttt
gccgacggcaacttcaactggggccgcgttgtcgccctgttttactttgccaccaagctg
gtactcaaggccctgtgcaccaaggtgcctgagctcatcaggactattatgggctggacg
ctggacttcctccgagagcggctgctgggctggatccaagaccagggtggttgggacggc
ctcctctcctacttcgggacccccacgtggcaaacgctgaccatcttgggggccggagtg
ctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system