KEGG   Oryctolagus cuniculus (rabbit): 100355793
Entry
100355793         CDS       T03373                                 

Gene name
SHISA5
Definition
(RefSeq) shisa family member 5
  KO
K10135  scotin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100355793 (SHISA5)
SSDB
Motif
Pfam: Shisa
Other DBs
NCBI-GeneID: 100355793
NCBI-ProteinID: XP_002713391
Ensembl: ENSOCUG00000022049
UniProt: G1TFA8
LinkDB
Position
9
AA seq 240 aa
MAPRTPAPRTLLLLLLSMLLPPPGACGEVCVASRGGTPAPDFCPDFCCGACDAQYCCSDV
LKKLVWNEEACAGPETSAPANTEPLEQLGSALRFRSSFDTDPMSGFGATVAIGLTIFVLS
VVTIIICFTCSCCCLYKMCRRPRPVVTTTTATTVVHAPYPQPPSAPPSYPGPTYQGYHPM
PSQPGVPAAPYPTQYPPPYLAQPMGPPAYHETLAGGAATPYLASQPPYNPAYTDPPRAVP
NT seq 723 nt   +upstreamnt  +downstreamnt
atggccccgcggacccccgcgcctcggacgctgctgctgctgctgctgtccatgctgctg
ccgcctccgggagcttgcggagaggtgtgcgtggcgtcccgtggaggaaccccggccccc
gacttctgtcctgatttctgctgtggcgcctgcgacgcccagtactgctgctcggacgtg
ctcaagaagttggtgtggaacgaggaggcatgtgctgggcctgagaccagtgcccccgcc
aatacggagccgctggagcagttgggctcggcgctgaggtttcggtccagcttcgacact
gaccccatgtcagggttcggcgcgacagtggccatcggcctgaccatcttcgtgctgtct
gttgtcaccatcatcatctgcttcacctgctcctgctgctgtttgtacaagatgtgccgc
cggccgcgcccggttgtcaccaccacaacggccaccacggtggtgcatgccccttaccca
cagcctccaagtgcgccacccagctaccctggaccaacgtaccagggctaccacccgatg
ccctcccagcccggcgtgccggcggccccctatccgacgcagtacccacccccgtacctg
gcccagcccatgggcccgcctgcttaccacgagacgctggctggaggagcagctacgccc
taccttgccagccagccgccctacaacccggcctacacggatcccccgagagcagtcccc
tga

DBGET integrated database retrieval system