KEGG   Oryctolagus cuniculus (rabbit): 100355808
Entry
100355808         CDS       T03373                                 

Gene name
TNFSF10, TNLG6A
Definition
(RefSeq) tumor necrosis factor superfamily member 10
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04068  FoxO signaling pathway
ocu04210  Apoptosis
ocu04217  Necroptosis
ocu04650  Natural killer cell mediated cytotoxicity
ocu05132  Salmonella infection
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100355808 (TNFSF10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355808 (TNFSF10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100355808 (TNFSF10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100355808 (TNFSF10)
   04217 Necroptosis
    100355808 (TNFSF10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100355808 (TNFSF10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100355808 (TNFSF10)
  09172 Infectious disease: viral
   05164 Influenza A
    100355808 (TNFSF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100355808 (TNFSF10)
   04052 Cytokines and growth factors [BR:ocu04052]
    100355808 (TNFSF10)
   04090 CD molecules [BR:ocu04090]
    100355808 (TNFSF10)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100355808 (TNFSF10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100355808 (TNFSF10)
CD molecules [BR:ocu04090]
 Proteins
  100355808 (TNFSF10)
SSDB
Motif
Pfam: TNF C1q DUF4381
Other DBs
NCBI-GeneID: 100355808
NCBI-ProteinID: NP_001316014
Ensembl: ENSOCUG00000014848
UniProt: G1T884
LinkDB
Position
14
AA seq 304 aa
MGHSDPDRGMSSVQALGGPSAGQTCVLILIFTVLLQSLCVAVTYLYFTNELKQMQDKYSK
SGIACLLKEDDSSWDSIDEENMNSPCWQAKWQLRQFIRKMLLRTYEETIPTVEGKKPQTI
PSLVREKERERGPQRVAAHLTGNSWRSFISVPAPGSQSGKNLGQKISSWESSRKGHSFLN
NLHLRNGELVIHQTGLYYIYSQTYFRFQELEEISGTISREEIKKRNKQMVQYIYKWTSYP
DPILLMKSARNSCWSKDSEYGLYSIYQGGIFELKENDRIFVSVTNEQLIDMNQESSFFGA
FLIG
NT seq 915 nt   +upstreamnt  +downstreamnt
atggggcattcagacccagacagaggcatgtcctctgtgcaggccctggggggccccagt
gccgggcagacctgcgtgctgatcctgatcttcacagtgctcctgcagtccctctgtgtg
gccgtgacttacctgtacttcaccaacgaactgaagcagatgcaggacaagtactccaaa
agtggcatcgcttgtctcttaaaggaggatgacagttcctgggactccatcgacgaagag
aacatgaacagcccctgctggcaggccaagtggcagctgcggcagttcattcgaaagatg
cttttgagaacctatgaggaaaccattcctacggttgaaggtaaaaagccacaaactatt
ccttccctagtaagagaaaaagaaagagaaagagggcctcagagagtagcagctcaccta
actgggaacagctggagaagctttatctcagtccctgctccaggctcccagagtggaaag
aatttgggccagaaaataagctcctgggaatcatcaaggaaaggacattcattcctgaac
aatttgcacctgaggaatggagagctggttatccatcaaacaggactttattacatctac
tcccaaacatactttcgatttcaggaacttgaagaaatttcaggaacaatttcaagagaa
gagatcaaaaagaggaacaaacaaatggtacaatatatttacaaatggacaagctaccct
gaccctatacttctgatgaaaagtgctagaaatagttgttggtctaaggattcggaatat
ggactctattccatctatcaaggaggaatatttgagcttaaggaaaatgaccgaattttc
gtctctgtaacgaatgagcagttgattgacatgaaccaagaatccagtttttttggggcc
tttttgattggctaa

DBGET integrated database retrieval system