KEGG   Oryctolagus cuniculus (rabbit): 100355820
Entry
100355820         CDS       T03373                                 

Gene name
SMG6
Definition
(RefSeq) SMG6, nonsense mediated mRNA decay factor
  KO
K11124  protein SMG6 [EC:3.1.-.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100355820 (SMG6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100355820 (SMG6)
   03032 DNA replication proteins [BR:ocu03032]
    100355820 (SMG6)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     100355820 (SMG6)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     100355820 (SMG6)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100355820 (SMG6)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    100355820 (SMG6)
SSDB
Motif
Pfam: EST1_DNA_bind PIN_4 EST1 MCD_N
Other DBs
NCBI-GeneID: 100355820
NCBI-ProteinID: XP_002718926
Ensembl: ENSOCUG00000013018
UniProt: G1T4K3
LinkDB
Position
19
AA seq 1420 aa
MAEGLERVRISASELRGILATLAPQAGSRENMKELKEPRPRKDNRRPDLEIYKPGLSRLR
NRPKIKEPSGSEEFKDEIANDRESAVGNDTQIIKDACKDLDSQQQNGPIDLENNRGQESF
PRTVGQEDRSLRIIKRTKKPDLQIYQPGRRLQTVTKEPAVRADEEEILNQVEQLRVQEDD
YRGKIVKEEIVNKTDKTETDKSPNSERVRTAKGEKGKRVEKGEGVKKVTDDGGQGKPGSA
KRYSRSDKRRNRYRTCSTSSAGSNNSAEGAGLTDNNGCRRRRQDRTKERPRLKKQVSMSS
TDSLDEDKIDEPDGLGPRKSSERKKHLERNWSANGEGEQKSNGKENRGTLRVTFDAETMN
KDSPMVRSAREDVERVKLDRGLSSGGKGSEKQESKNLKQELRGRGRGILILPAHTTLSVN
SAGSPESTPLGPRPLFGSGSKGSRSWGRGGTTRRLWDPNNPDQKPALKSQVPQLHFLDTD
DEVSPTSWSDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYSPLQYPMGPTNGVYP
GPYYPGYPTPSGQYVCSPVPASTMSPEEIEQHMRNVQQQELHRLLRVADNQELQLSNLLS
RDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLLK
DPNVENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKY
ALISAQRCMICQGDISRYREQANDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTR
RKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQTEKKQHEELELSSDQWRKGKK
STFRHVGDDTTRLEIWIHPSHPRSSQGTESGKDSEQENGLGSLSPSDLNKRFILSFLHAH
GKLFTRIGMETFPAVAEKVLQEFQVLLQHSPSPIGSIRMLQLMTINMFAVHNSQLKDCFP
EECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDQDQDDIKVSSFVPDL
KELLPSVKVWSDWMLGHPDTWNPPPTSLDLPSRVAVDVWSTLADFCNILTAVNQSEVPLY
KDPDDDLTLLILEEDRLLSGFVPLLAAPQDPCYVEKTSEKVIAADCKRVTVLKYFLEALC
GQEEPLLAFKGGKYVSVAPVPDTMGKEMGSQEGKQLEDEEEDVVIEDFEEDSEAEGSGGE
DDIRELRAKKLALARKIAEQQRRQEKIQAVLEDQSQMRQMELEIRPLFLVPDTNGFIDHL
ASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLERRFE
SRDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPTSKEEP
IRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG
NT seq 4263 nt   +upstreamnt  +downstreamnt
atggcggaggggttagagcgtgtgaggatctccgcgtcggagctgagagggatcctggcc
actctggctccgcaggccgggagcagagaaaacatgaaggaattaaaggagcccaggcca
cgtaaagataacaggcgcccagatttggaaatctataagcctggtctttctcgactaagg
aacagacctaagatcaaggaaccctctgggagtgaggaatttaaggatgaaattgctaat
gacagagagtctgctgttggaaatgacacacagatcattaaagatgcctgcaaagacctg
gacagccaacagcaaaatggtcctatagacctagaaaataatcggggacaggaatccttt
cctaggactgttggacaagaggatcgaagtctaagaattattaagagaacaaagaaaccg
gacctgcagatctatcagcctgggcggcgtttacaaactgttaccaaagaacctgctgtt
cgggcggatgaggaagaaatcctcaaccaggtagaacagctgagagtacaggaagatgat
tataggggcaaaattgtgaaagaggaaatcgtgaataagacagataaaactgagacagac
aagagcccaaatagtgagagagtaaggactgcaaagggagaaaaaggaaagagggttgaa
aaaggggagggggtgaaaaaagtgactgatgatgggggccaggggaagccaggttctgca
aagcggtactcccgctcagataaacgaaggaaccgttaccgcacttgtagtaccagctca
gcgggtagcaacaacagtgctgagggagctggcctgaccgataataatggatgtcgccgc
cgccgacaggatcggaccaaggagaggccacgactgaagaagcaagtatcgatgtcttca
actgactccttagatgaggataaaattgatgagcctgatggattaggacccaggaagagc
tcagaaaggaagaaacatttagaaagaaactggtctgccaatggggagggcgagcagaaa
agcaatggtaaagaaaatcgaggcactcttcgtgtcacttttgatgcagaaaccatgaac
aaagattcccccatggtgaggtcagccagggaggatgtggagagggtaaagcttgacaga
ggcttgagcagtgggggcaagggctctgagaagcaagagtctaaaaacttgaaacaagaa
cttcggggtcgtgggcgtggcattctgattctgcctgcccataccactctgtctgtgaat
tcggcaggctctccagagtctacacctttgggacctcggcctttatttggatctggtagt
aaggggtctcggagctggggtcgtggaggcacaacccgccgattgtgggacccaaataat
cctgaccagaagcctgctttaaagagccaggtgccccagctacatttcttggacactgat
gatgaagtcagccctacatcttggagtgactctcgccaggcccaagcatcttactataag
tttcaaaattctgacaacccctattattacccccggacaccagggcctgcttcccagtat
ccctatacaggctatagccctttacagtatccaatgggccctacaaatggtgtgtaccca
ggaccttactacccaggctacccgaccccatctggacagtatgtctgtagccccgtccct
gccagcaccatgagccctgaggagatagaacagcacatgagaaatgttcagcaacaggag
ctacacaggcttctccgggtggctgataaccaggaactgcagctcagcaacctgctctcc
agggaccgcatcagtcctgagggcctggagaagatggctcagctcagagctgaactactg
cagctatatgagcgctgtattctattagatattgagttctctgataatcagaatgtggat
cagatcctgtggaagaatgctttctatcaggtgattgagaagttcaggcagcttctcaag
gatccgaatgttgaaaatccagaacagattcggaacagacttttggaactcttagatgag
ggtagtgacttctttgatagtttgcttcagaagctgcaggttacttacaagttcaaactg
gaggactacatggacggtcttgccattcgcagcaagccattacgcaagacagtaaaatat
gccttgatcagtgcccagcgatgtatgatatgccaaggagatatctctaggtatcgggaa
caagccaatgatacagcaaactacgggaaagcacgcagttggtacctgaaggcccagcac
attgctcccaagaatgggcgcccctataaccagttggctttgctggcagtgtatacgagg
aggaagcttgatgctgtgtattactatatgcgcagcctagcggccagcaaccctatcctg
actgccaaggaaagtctcatgagcttgtttgaagagaccaaacgaaaggcagagcagacg
gaaaagaagcagcatgaggaacttgaactgagctctgaccaatggcggaaaggaaagaag
tctactttccggcatgttggagatgatactactcgcctggagatctggatccatccatcc
catccccggtcctcccagggcaccgagtctgggaaggattccgagcaggagaatggactg
ggcagcctaagccccagtgatctgaacaaaaggttcatcctcagttttctccatgcccat
gggaagctgtttacccggattgggatggagacattccctgcagtggctgagaaggtcctc
caggagttccaggtgttactgcagcacagcccctctcctattggaagtatccgtatgctg
cagcttatgaccatcaacatgtttgctgtacataactcccagttgaaagactgcttcccg
gaggagtgccgctccgtgatccaggagcaggctgcagccctgggtttggccatgttctct
cttctggtccgccgctgcacctgcttacttaaggagtctgccaaagctcagctgtcctct
cctgaggatcaggatcaggaccaagatgacatcaaggtgtcttccttcgtcccagacctc
aaggaactgcttcccagtgtgaaagtctggtcagactggatgcttgggcatccagacacc
tggaatcccccacccacgtccctggatctgccctcgcgggttgctgtggatgtgtggtcg
acgctggctgatttctgtaacatactgactgcagtgaaccagtcagaggtgccactgtat
aaggacccggacgatgacctcacccttctcatcctggaagaggatcggcttctctcgggc
tttgtccccttgctggctgcccctcaggacccctgctacgtggagaaaacctcggagaag
gttattgcagccgactgcaaaagggtcacagtgctgaagtattttctggaagccctttgt
ggacaagaagagcctctgctggcattcaagggtggaaaatatgtgtcagtggcacccgtc
ccagacaccatgggaaaggaaatgggaagccaagagggaaaacaactggaagatgaggag
gaggacgtggtgattgaagactttgaggaagactcggaggctgaaggcagcggaggcgag
gatgacatcagggaacttcgagccaagaagctggctctggccaggaaaatagccgagcag
cagcgtcgccaagaaaagatccaggctgtcctggaagaccagagtcagatgaggcagatg
gaactcgagatcagacccttgttcctcgtcccagacaccaatggcttcatcgaccacctg
gccagtctagcccggctgctggagagcaggaagtacatcctggtggtacccctcatcgtg
atcaatgagctggacggcctggccaaagggcaagagacagaccaccgggctgggggctat
gcccgtgtggtacaagaaaaggcccgcaagtccatcgagttcctcgagcgacgattcgag
agtcgggattcttgtctgcgggccctgaccagccgtggcaatgaacttgaatccatcgcc
ttccgcagtgaggacatcactggccaactgggtaacaacgatgacctgatcctctcctgc
tgcctccactactgcaaagacaaggctaaggacttcatgcctacaagcaaagaagagccg
atccggctgctgcgggaggtggtgctgttgacagatgaccggaacctacgtgtgaaggca
ctgaccaggaatgtgcctgtgcgggacatccctgccttcctcacgtgggcccaggtgggc
tga

DBGET integrated database retrieval system